KEGG   Corynebacterium pseudotuberculosis C231: CpC231_1347Help
Entry
CpC231_1347       CDS       T01877                                 

Gene name
trpC2
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CpC231_1347 (trpC2)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CpC231_1347 (trpC2)
Enzymes [BR:cpq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CpC231_1347 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1484419..1485240)
Genome map
AA seq 273 aa AA seqDB search
MGRVMPSVFEEIIAGVIEDVAARESVVSFKEIKARSRACEPPRDAIAALLNSGCGVIAEI
KRAAPDKGVLAEINSPVGLAKELVAGGASLIACQTERRRFHGSLSEMAEIRNVISVPIMC
RDFIVDPYQIHEARCYGADMVPLRVAALDQARMIALIDRIESLGMAALVEVRDTEEASRA
VAAGAKIIGVNARDFSTMTLNRLAFAEIAPGLPTDVIRVALSGVRNARELLDYAASGADA
VVVGEKIVTAADPCEATRSLVAAGQHPSCPSRG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgggacgggttatgccatcagtcttcgaagagattattgcgggcgtcattgaagatgta
gctgcgcgagaatcagtggtgtcgtttaaagagatcaaagcccgttcgcgtgcttgcgag
ccgcctcgggatgcaatagcggcgcttcttaatagtggttgtggcgtgatcgctgagatt
aaacgtgctgccccagataaaggcgttttagcagagatcaattctcctgttggcttagca
aaagaacttgtcgccgggggcgctagtttgattgcgtgtcagacggaacggcgaaggttc
cacggttcattatctgagatggctgagattcgtaatgtgatatcggtgccaataatgtgc
cgagacttcatcgtggatccctatcaaattcatgaggcgcgctgttatggagcggacatg
gtgcccttgcgcgtagctgctttagaccaagccaggatgattgcgcttatagatagaatc
gagtccctgggaatggcagcgctggtagaagtccgggatactgaggaagcatcgcgtgcg
gtggcagcgggtgcgaagatcataggggtaaacgcccgggatttctcaacgatgacgctc
aaccgcctggccttcgcagaaattgctcctggacttcccacagatgttattagagttgca
ttgtccggtgtgcgcaatgctcgtgaactcctggattacgctgcctctggtgcggacgcg
gtggttgtgggagaaaaaattgttactgctgcggatccgtgcgaagcgacgcgttcgttg
gtggcagcaggccaacatccatcgtgtccatcgcgaggataa

DBGET integrated database retrieval system