KEGG   Corynebacterium pseudotuberculosis C231: CpC231_2056Help
Entry
CpC231_2056       CDS       T01877                                 

Gene name
nanK
Definition
N-acetylglucosamine kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CpC231_2056 (nanK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpC231_2056 (nanK)
   00052 Galactose metabolism
    CpC231_2056 (nanK)
   00500 Starch and sucrose metabolism
    CpC231_2056 (nanK)
   00520 Amino sugar and nucleotide sugar metabolism
    CpC231_2056 (nanK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CpC231_2056 (nanK)
   00524 Butirosin and neomycin biosynthesis
    CpC231_2056 (nanK)
Enzymes [BR:cpq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CpC231_2056 (nanK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2274801..2275694)
Genome map
AA seq 297 aa AA seqDB search
MQTPVRIGVDIGGTKIAAGLVADANPTTVIEYRRRPTPASNVIQEVAGVIQELIDVSPTA
VSSIGIGAPGVIDPIEGNVVSSGPTMQGWAGTKIADTLREQFPVPVAVHNDVRVMGLGES
IYGAGQDFNNILFVSLGTGVGGALVRDGGLVASPHCTAGELRCLWGRLPDGSAALLESFA
SGPGLVDSYNAYAEHPAVDLHEIMARYHAGEEYARGVIEEHLFACGVAIGGFISAIDVDA
VVVGGGVGNIGDAIINPFARGLKEGAIPPLDAVPVIQAQLGTDAPIVGAAYLGKTQD
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaacccccgtacgcattggcgtggatattggtggaaccaagatcgcggcgggcctg
gtggcggatgctaaccccaccaccgttattgagtatcgtcgtcggcctacgcccgcgagc
aatgtgatacaagaggtcgctggcgttatccaagagcttatagacgtctcccctaccgcg
gtttcgagcataggaatcggtgctccaggggtcattgatcccatagaaggcaacgtagtg
tcctcggggccgaccatgcagggatgggcgggaactaagatcgcggatacgctgagggaa
caattcccggttcccgttgccgtgcataacgacgtccgcgttatggggctgggcgagtcc
atctatggcgctggtcaggactttaacaatattctttttgtcagcctgggcactggcgtg
ggcggggcacttgtgcgtgatggtgggcttgttgcctcgcctcactgtaccgctggagag
ctgcgttgcctgtggggacggctccccgatggatccgctgccctcttagagtccttcgcc
tctggtcctggactcgttgactcctataacgcgtatgcggagcacccagccgtggatctc
cacgagattatggctcgataccacgcgggtgaagaatatgcgcggggtgttattgaggaa
catctctttgcgtgcggggttgctatcggcgggtttattagtgccattgacgtggatgct
gtggtggtcggcggtggcgtgggcaatattggcgatgccattattaacccctttgctcgt
gggctaaaagaaggcgccatccctccactcgatgcagtaccagttatccaggcacagcta
ggaaccgatgctcccatcgtaggagccgcatatctggggaagacccaagactaa

DBGET integrated database retrieval system