KEGG   Corynebacterium pseudotuberculosis C231: CpC231_2066Help
Entry
CpC231_2066       CDS       T01877                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cpq  Corynebacterium pseudotuberculosis C231
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpC231_2066
Enzymes [BR:cpq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CpC231_2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2286017..2286556)
Genome map
AA seq 179 aa AA seqDB search
MTTTFNMPEDRGHLISASTSACGEILFMSSIPDMALGGSIRGGVPIIAPWFGKLMGHKEL
QHGWARRQKWEVLETSGGLDARMSHDDWDLRLAVQSTPRGFAMMLKCRNASSVCRKLQLA
FHPYFYVSDVLDTIVTAPGETFTTDGGLLEEFRLSAPTPLLIDDGQRLITVKGQGTDHR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaacttttaacatgcccgaagatcgcggccaccttatctctgccagtacctct
gcctgcggtgaaatactctttatgtccagcattccagatatggcgttggggggttccatt
cgtggtggtgtgcccattattgctccgtggtttggcaaacttatggggcacaaggagctg
caacatggatgggcgcgccggcagaaatgggaggtgctagagacctcgggtgggctcgac
gctcgaatgagtcatgatgattgggacttgcgtttggcagtccagtcgacgccgcgaggt
tttgccatgatgctgaaatgtagaaacgcctcaagcgtttgccggaagcttcagttggcg
ttccatccatatttttatgtctctgacgttcttgataccatcgtgaccgcccccggtgag
acctttactacggacggtggtttgttggaggaatttcgcctctccgctcccacgcctctg
cttatcgatgacggccagcgtctcatcaccgttaaagggcaagggactgatcaccgttaa

DBGET integrated database retrieval system