KEGG   Clostridium perfringens SM101: CPR_0054Help
Entry
CPR_0054          CDS       T00379                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cpr  Clostridium perfringens SM101
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cpr00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(60140..60625)
Genome map
AA seq 161 aa AA seqDB search
MFSIIVAKSINNIIGVNNKIPWNIPSDLKRFKELTMGKKILMGRKTFESLPFVLPGRTHL
VLTTKKDFSYNHKDVIIYNDLDKLISEYKDSMEEIFVIGGGKIYSEFLKYASKLYITEVL
KEYKGDTYFPKVDYSKWIKTYESSIYEENATKFKYVIYEIL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgttttctataattgttgccaaaagtattaataatatcattggagttaataacaaaata
ccttggaatattccatctgatctaaaaagatttaaagaacttactatggggaaaaaaata
ttaatgggaagaaaaacctttgaatctcttccttttgttttacctggaagaactcattta
gttttaactacaaagaaagatttttcttataatcataaagatgtaattatttataatgat
ttagataagcttatttctgaatataaagatagcatggaagaaatatttgtaataggtggt
gggaaaatatattctgagtttttaaaatatgcttcaaaattatatataactgaagtttta
aaggaatataaaggagatacttatttccctaaagtagattattctaaatggataaaaact
tacgaaagttctatttatgaagagaatgctactaaatttaaatatgtaatatatgaaatt
ttataa

DBGET integrated database retrieval system