KEGG   Clostridium perfringens SM101: CPR_0054Help
Entry
CPR_0054          CDS       T00379                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr00670  One carbon pool by folate
cpr00790  Folate biosynthesis
cpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CPR_0054 (folA)
   00670 One carbon pool by folate
    CPR_0054 (folA)
Enzymes [BR:cpr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CPR_0054 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ABG86846
UniProt: Q0SWS9
Position
complement(60140..60625)
Genome map
AA seq 161 aa AA seqDB search
MFSIIVAKSINNIIGVNNKIPWNIPSDLKRFKELTMGKKILMGRKTFESLPFVLPGRTHL
VLTTKKDFSYNHKDVIIYNDLDKLISEYKDSMEEIFVIGGGKIYSEFLKYASKLYITEVL
KEYKGDTYFPKVDYSKWIKTYESSIYEENATKFKYVIYEIL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgttttctataattgttgccaaaagtattaataatatcattggagttaataacaaaata
ccttggaatattccatctgatctaaaaagatttaaagaacttactatggggaaaaaaata
ttaatgggaagaaaaacctttgaatctcttccttttgttttacctggaagaactcattta
gttttaactacaaagaaagatttttcttataatcataaagatgtaattatttataatgat
ttagataagcttatttctgaatataaagatagcatggaagaaatatttgtaataggtggt
gggaaaatatattctgagtttttaaaatatgcttcaaaattatatataactgaagtttta
aaggaatataaaggagatacttatttccctaaagtagattattctaaatggataaaaact
tacgaaagttctatttatgaagagaatgctactaaatttaaatatgtaatatatgaaatt
ttataa

DBGET integrated database retrieval system