KEGG   Clostridium perfringens SM101: CPR_0057Help
Entry
CPR_0057          CDS       T00379                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cpr  Clostridium perfringens SM101
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPR_0057 (recR)
DNA repair and recombination proteins [BR:cpr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CPR_0057 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
63007..63603
Genome map
AA seq 198 aa AA seqDB search
MEFYPVAIEKLIEEFAKLPSIGKKSAQRLTLHILNLPKDEVEEFANALVKARGTIKYCSV
CGNFTDTDPCAICSNPNREKDIICVVEQPKDIMTMEKVKEFNGLYHVLHGTISPMQGRGP
QDIRIRELVARMSGDVKEVIVATNPTIEGEATAMYISKILKPLDVKVTRIAAGIPVGGDL
EYADEVTLSKALEGRTVI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaattttatccagtagctatagaaaagttaattgaagagtttgctaagttacctagt
ataggaaaaaaatcagctcaaagattaactttacatattttgaatttgccaaaggatgag
gtagaggaatttgcaaatgccttagtaaaagcaagaggaactattaaatattgttctgta
tgtggtaactttacagatacagatccatgtgcaatatgttcaaatcctaatagagaaaaa
gatataatatgtgtggttgaacaacctaaggatattatgacaatggaaaaagttaaagaa
tttaatggtttatatcatgttttacatggaactatttctccaatgcaaggaagaggacca
caggatataagaataagagaattagtagcaagaatgagcggagatgtaaaagaggttatt
gtagctacaaaccctactattgaaggggaagctacagctatgtatatttcaaagatatta
aagccattagatgttaaggttactagaattgcagcaggaatcccagttgggggagattta
gagtatgcagatgaagtaactttatctaaagcattagaaggtagaactgttatataa

DBGET integrated database retrieval system