KEGG   Clostridium perfringens SM101: CPR_0098Help
Entry
CPR_0098          CDS       T00379                                 

Definition
glucose kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cpr  Clostridium perfringens SM101
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPR_0098
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPR_0098
   00052 Galactose metabolism
    CPR_0098
   00500 Starch and sucrose metabolism
    CPR_0098
   00520 Amino sugar and nucleotide sugar metabolism
    CPR_0098
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CPR_0098
   00524 Butirosin and neomycin biosynthesis
    CPR_0098
Enzymes [BR:cpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CPR_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
126191..127138
Genome map
AA seq 315 aa AA seqDB search
MKNYVVGIDLGGTKISCALADLEGNVKAQHTTPTNAHEGEQAVLDRIIGCVETVICEGKV
TIDEVEAIGIGSPGPLDARTGIIITTPNLPFKNFNLVSPLKAKFGIPVYLDNDANVAAIG
EFMLGAGKGTENMIYITVSTGVGGGAILNGKIYRGSTSNALEIGHSTVAPGTVRCNCGNM
GCLEAVSSGTAIGKRGREAVATNVETSLKDYDNVTSYEVFVEAAKGDRVAKSIIDEALNY
LGIGVANAIATFDPDMVVIGGGVSKAGEVVFETVQEVVNERCFKAMAEHCKIVPAGLGTD
AGVIGAVALALLECK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattacgttgttggaatagatctagggggaacaaaaattagctgtgctcttgct
gatctagaaggaaatgttaaagctcaacatacaactccaactaatgctcatgaaggagag
caagcagttttagatagaattataggctgtgttgaaactgtaatatgtgaaggaaaagta
actattgatgaagtagaagcaataggtattggatcaccaggaccactagatgctagaact
ggtataataataacaactccaaatttacctttcaaaaacttcaacttagtttcaccatta
aaagctaagtttggtattcctgtttacttagataatgatgctaacgtagctgctataggt
gaatttatgttaggtgctggaaaaggtactgaaaatatgatttatataactgtaagtact
ggtgtaggtggaggagcaatccttaacggtaaaatttacagaggaagtacttcaaacgca
ttagaaattggacattcaactgttgcacctggaactgtaagatgtaattgtggtaacatg
ggatgtctagaagctgtatcatcaggaacagctattggtaaaagaggaagagaagcagtt
gctacaaatgtagaaacaagcttaaaagattacgacaatgtaacttcatatgaagtattt
gttgaagcagctaaaggtgatagagttgcaaaatcaataatagatgaagctttaaactac
ttaggaattggtgttgcaaatgcaatagcaacttttgacccagacatggttgttataggt
ggaggagtttcaaaagctggagaagttgtttttgaaacagttcaagaagttgttaatgaa
agatgttttaaagctatggctgagcattgtaaaatagttcctgctggattaggaactgat
gcaggagttattggagcagtagctttagcattattagagtgcaaataa

DBGET integrated database retrieval system