KEGG   Clostridium perfringens SM101: CPR_0156Help
Entry
CPR_0156          CDS       T00379                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cpr  Clostridium perfringens SM101
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CPR_0156
Enzymes [BR:cpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CPR_0156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
190582..192651
Genome map
AA seq 689 aa AA seqDB search
MKNYGPISSKVTKMLHGADYNPEQWIDIPNIWGEDVRLMKLSHTNVVAVGIFSWTMLEPE
EGKFNFEWLDEIMDLMHKNGNYVILATPSGAKPIWMAHKYPETLRVAPNRVRNLYGERHN
HCYTSPIYREKIAIIDRLLAERYKDHPALILWHISNEFEGQCYCPLCEQAFRDFLRKKYD
NDINKLNKAWWTKFWSHTYASFDEIEAPAPHGEPALHGLNLDWMRFVTHQTLDYYKHERS
ILKEITPDIPVTTNFHDYISLFRGIDYWKFAPYLDVVSWDNYPYWHGERTDDHEGSRIGF
IHDLNRAILNGKPFMMMESSPSSTNWQPVAKLRRPGMHVLSSLQAVAHGSDTVQYFQWRK
SRGSSEKFHGAVVDHCGHENTRVFRDVTKVGEILSKLDDVIGTSVEPQVAVIYDWENYWA
INDAQGPRIEQKDYFETCQKHYKAFWDMSIPTDVINMDCDFSKYKVVVAPMLYMVRPGVG
ERLEEFVNNGGTLVTTYWSGIVDENDLCFLGGFPGPLKKVTGIWAEELDALYDEDVNYVS
IEEGNSLGMKGEYEARIFCDLIHSEGAEILATYKTDFYKGMPALTCNNFGEGQAYYIAFR
NNDEFLSDFYSSLAKKLTLKRAIEIDLPNGINAQVRMDEKNEFVFFMNFSSEEKTIDIKD
LDLTDMVTGEKVTKEMEIEPYGVRIVRRK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaattatggaccaataagttctaaagtaacaaaaatgcttcatggagcagattac
aacccagagcaatggattgatatacctaacatatggggagaagatgttagattaatgaag
ctttctcatacaaatgttgtagctgtaggcatattttcatggacaatgttagagcctgaa
gaaggtaagtttaactttgaatggttagatgaaatcatggatttaatgcacaagaatgga
aactatgtaatacttgctacaccaagtggagctaagccaatatggatggctcataagtat
ccagaaactttaagagttgctccaaacagagtaagaaacctttatggagagcgtcataat
cactgttatacatctcctatatatagagagaaaattgctataatagacagattattagct
gaaagatataaagatcacccagctttaatcttatggcatatttcaaatgagtttgaaggt
caatgttattgtcctttatgtgaacaagcttttagagatttcttaagaaagaaatatgat
aatgacataaataaattaaataaagcttggtggactaagttctggagccacacatatgct
tcctttgatgaaatagaagcaccagctcctcatggagagccagctcttcatggattaaac
ttagattggatgagatttgttactcaccaaactttagattactacaagcatgaaagaagc
atattaaaggaaatcacaccagatattcctgtaactactaacttccatgactatatttca
ttatttagaggaatagattactggaaatttgctccttacttagatgttgtatcatgggat
aactatccttactggcatggagaaagaacagatgaccacgaaggaagtagaattggattt
attcatgacttaaatagagcaattttaaatggtaagccatttatgatgatggaaagctca
ccaagttcaacaaactggcaaccagttgcaaaacttagacgtccaggaatgcatgtttta
tcttctcttcaagctgtagctcatggttcagatacagttcaatatttccaatggagaaag
agtagaggatcatcagaaaaattccatggagctgttgttgatcactgtggacatgaaaat
acaagagtatttagagatgtaactaaggttggagaaattctatcaaaacttgatgatgta
ataggaacttctgtagagccacaagtagctgttatttacgattgggaaaattactgggca
ataaatgatgctcaaggtcctagaatagagcaaaaggattactttgaaacttgtcaaaag
cactacaaagctttctgggatatgtcaattccaacagatgttataaacatggattgtgat
ttctcaaaatacaaggttgttgtagcaccaatgctttatatggtaagaccaggtgttgga
gaaagattagaggaattcgtaaataatggaggaactttagtaacaacttactggagtggt
attgttgatgagaatgacctttgcttcttaggaggattccctggcccattaaagaaagtt
acaggaatctgggctgaagaattagatgcactttatgatgaagatgtaaactatgtttct
attgaggagggaaatagtttaggaatgaaaggtgaatatgaagctagaatattttgtgac
ttaattcactcagaaggagctgaaattcttgcaacatacaaaacagacttctacaaagga
atgccagctttaacttgtaacaactttggagagggacaagcttattatatagcatttaga
aataatgatgagttcttatcagatttctactcaagcttagctaagaagttaactttaaag
agagctatagaaattgacttaccaaatggaattaatgctcaagttcgtatggatgaaaag
aatgagtttgtattctttatgaacttctcatcagaggaaaaaacaatagacattaaggat
cttgatttaacagatatggtaactggtgaaaaggtaactaaggaaatggaaatagaacct
tatggagttagaatagttagaagaaaataa

DBGET integrated database retrieval system