KEGG   Clostridium perfringens SM101: CPR_0341Help
Entry
CPR_0341          CDS       T00379                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpr  Clostridium perfringens SM101
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPR_0341 (pfkA)
   01230 Biosynthesis of amino acids
    CPR_0341 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPR_0341 (pfkA)
   00030 Pentose phosphate pathway
    CPR_0341 (pfkA)
   00051 Fructose and mannose metabolism
    CPR_0341 (pfkA)
   00052 Galactose metabolism
    CPR_0341 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CPR_0341 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CPR_0341 (pfkA)
Enzymes [BR:cpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CPR_0341 (pfkA)
Protein phosphatases and associated proteins [BR:cpr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CPR_0341 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
413062..414021
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAALRAVTRMALHHGLEVMGVQRGYAGLINGELFKMDRKSVSEI
INRGGTILRTARCLEFKQEEVREKAAQILKAYGVEALVVIGGDGSFMGAKLLSKLGVKTV
GLPGTIDNDLSYTDYTIGFDTALNTVVDAINKLRDTSTSHERVSIVEVMGRNCGDLALYA
GIAGGAEAIIVPEMPFDKDELIKTILEGRTNGKTHSIIVVAEGVGGSAELAKEIESVTGI
ETRATILGHIQRGGSPTADDIVLASRMGAKAVEVLLEGKTSKVIGIKENRIFDMDIDEAL
DIERSFDESLYEMASAINK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattgctgttttaacaagtggtggagatgcaccaggaatgaacgctgcctta
agagcagttacaagaatggctttacaccatggacttgaagtaatgggagttcaaagagga
tacgctggattaataaatggagaactattcaaaatggatagaaaatctgtttcagaaatc
ataaacagaggtggtacaatcttaagaactgctagatgtttagaattcaaacaagaagaa
gtaagagaaaaagctgcacaaatattaaaagcttacggtgttgaagctttagtagttata
ggtggagatggatcattcatgggagctaaacttctttcaaaattaggagttaagactgtt
ggattaccaggaacaatcgataacgacttatcttacacagattacactataggatttgat
actgcattaaacacagtagtagatgctataaacaaattaagagatacatcaacttcacac
gaaagagtatctatcgtagaagttatgggaagaaactgtggagaccttgctttatatgct
ggtatcgcaggtggagcagaagctataatagttccagaaatgccatttgataaagatgaa
ttaatcaaaactatcttagaaggtagaacaaatggaaaaactcacagcataatagttgtt
gctgaaggagttggaggatcagctgaattagctaaagaaatagaatctgtaactggtata
gaaactagagctacaattttaggtcacatccaaagaggtggatcaccaactgctgatgat
atagtattagcatcaagaatgggagctaaagctgtagaagttttattagaaggaaaaact
tcaaaagttataggaattaaagaaaatagaatattcgatatggatatagatgaagcttta
gatatagaaagaagctttgacgaaagtctttacgaaatggctagcgctataaacaaataa

DBGET integrated database retrieval system