KEGG   Clostridium perfringens SM101: CPR_0465Help
Entry
CPR_0465          CDS       T00379                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cpr  Clostridium perfringens SM101
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CPR_0465 (galU)
   00052 Galactose metabolism
    CPR_0465 (galU)
   00500 Starch and sucrose metabolism
    CPR_0465 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CPR_0465 (galU)
Enzymes [BR:cpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CPR_0465 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
552664..553584
Genome map
AA seq 306 aa AA seqDB search
MKNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILIITGR
SKKCIEDHFDKSVELEMELEKSGKNELLDLVRDISGMVDIHYIRQKEPRGLGHAIHCAKT
FVGDEPFAILLGDDVVYNEEKPCLKQLIGCYNEYKTSVLGVQTVPESHVSKYGIVDGKHI
EGKVYKVKGLVEKPSVEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELM
GQEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPELREGFVEYLNNLSEKESLFKKEVE
KEIVTV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataaaataagaaaagcaataataccagcagcaggtcttggaactagattttta
cctgcaacaaaggcacaacctaaggagatgcttccaatagttgataagccaactattcaa
tacataatagaggaagctatagcctcaggcattgaagagattcttattattacaggaaga
agtaaaaagtgtattgaggatcactttgataagtctgttgagcttgaaatggagcttgag
aaatctggtaagaatgagcttttagatttggttagggatatatcaggtatggtagacatt
cattatataagacaaaaggagccaagaggacttggacatgctatacattgtgcaaagact
tttgtaggagatgaaccttttgctatactacttggggatgatgtagtttataatgaggaa
aaaccatgtctaaaacagttaattggttgttataatgagtataaaactagtgtactagga
gttcaaactgttccagaaagtcatgtttctaaatatggaatagtagatggaaaacatatt
gaaggaaaagtttataaggttaagggattggttgaaaaaccatctgttgaagaagcccct
tcaaatgttgctatattaggaagatacatagtaactccaagaatatttgatattttagaa
aatactaagcctggaaagggtggagaaatccaattaacagatgctcttttagaacttatg
ggacaagaagcaatgtatgcttatgactttgagggaagaagatatgatgttggagataaa
cttggatttttagaagctactgttgaatatgctttaagaagaccagagcttagagaagga
tttgttgaatatctaaataatttatcagaaaaagaatctttattcaaaaaagaagttgaa
aaagagattgttactgtataa

DBGET integrated database retrieval system