KEGG   Clostridium perfringens SM101: CPR_0469Help
Entry
CPR_0469          CDS       T00379                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cpr  Clostridium perfringens SM101
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CPR_0469 (galU)
   00052 Galactose metabolism
    CPR_0469 (galU)
   00500 Starch and sucrose metabolism
    CPR_0469 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CPR_0469 (galU)
Enzymes [BR:cpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CPR_0469 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
558338..559282
Genome map
AA seq 314 aa AA seqDB search
MNNKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEEILVITGR
SKKAIEDHFDRNVELEMELEKSGKTELLDLVRDISDMVDIHYIRQKEPRGLGHAIHCAKT
FVGDEPFAILLGDDVVYNEEKPCLKQLIECYNEYRTSVLGVQTVPEENVSKYGIVNGKHI
EGRVYKVKGLVEKPSPEEAPSNVAILGRYIVTPRIFDILENTKPGKGGEIQLTDALLELM
REEAMYAYDFEGRRYDVGDKLGFLEATVEYALRRPDLRDGFIDYLRELSATENIFTEANG
KEKKDKEEELVTEA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataaaataagaaaagctataataccagcagcagggcttggtactagattctta
cctgcaacaaaggctcagcctaaggagatgcttccaatagttgataaaccaactattcaa
tacataattgaggaggctatagcttcaggtatagaggaaatacttgttattacaggaaga
agtaaaaaggctattgaagatcactttgaccgtaatgtggaacttgaaatggaacttgaa
aagtcaggaaaaactgaacttttagatttagttagagatatatcagatatggttgatatc
cattatataagacaaaaagaaccaagaggacttggacatgctatacattgtgctaagact
ttcgtaggggatgaaccttttgccatattacttggtgatgatgtagtttataatgaagaa
aagccatgtttaaagcaattaattgagtgttataatgaatatagaactagtgtattaggt
gttcaaactgttccagaagaaaatgtttctaaatacggaatagttaatggaaaacatatt
gaaggtagagtttataaagtaaaaggcttagttgaaaagccatcaccagaagaagcacct
tcaaatgttgctatattaggaagatatatagtaactccaagaatatttgatatattagaa
aacacaaaacctggtaaaggtggagaaattcaattaacagatgcacttttagagcttatg
agggaagaagctatgtatgcttatgactttgaaggaagaagatatgatgtgggagataaa
cttggattcttagaagctactgttgagtatgctttaagaagaccagatcttagagatggg
tttattgattacttaagagaattatctgctacagaaaatatctttactgaagcaaatggt
aaagaaaaaaaggataaagaagaagagcttgtaacagaagcttaa

DBGET integrated database retrieval system