KEGG   Clostridium perfringens SM101: CPR_0516Help
Entry
CPR_0516          CDS       T00379                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cpr  Clostridium perfringens SM101
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CPR_0516 (speB)
Enzymes [BR:cpr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CPR_0516 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
611458..612315
Genome map
AA seq 285 aa AA seqDB search
MLMNRNVSTFIGCEAEYDESSIVVFGAPFDSTTSFRPGTRFASQVMRGESWGLESYSPYQ
DLDLYDFNIFDGGEIELPFGNSEGALALIEDFSTKVVEDGKIPAMIGGEHLVTLGAFKGV
FKKYPDVHVIHFDAHADLREDYLGQKLSHATVIHRVWDLVGDNKIFQFGIRSGEKEEFLW
AKDHVYTNKFNCDTLDYALEMVKDKPVYVTIDLDVLDPSVFPGTGTPEPGGIQFNELLNS
ILKLRGLNIVGFDINELSPQYDQTGASTAVACKVLREMLLVANNK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgaatagaaatgtaagcacttttatagggtgtgaagctgaatatgatgaatca
agcatagttgtatttggagctccttttgattcaacaacttcttttagaccaggtactagg
tttgcaagccaagtgatgagaggagaatcttggggattagaaagttatagtccatatcaa
gacttagatctttatgattttaatatttttgatggaggagaaatagagcttcctttcgga
aattcagagggagcattagctttaatagaggatttttcaactaaggttgttgaagatggg
aaaataccagctatgataggtggagagcatttagtaactttaggggcatttaaaggagta
tttaaaaaatatcctgatgttcatgtaattcactttgatgctcatgcagatttaagagaa
gattatttaggtcaaaaactatctcatgctactgttatacatagagtttgggatttagta
ggagataataaaatattccaatttggaatacgttctggtgaaaaagaagaatttttatgg
gcaaaggatcatgtttatacaaataagtttaattgtgatactttagattatgccttagaa
atggttaaagataaacctgtttatgtaacaatagacttagatgttttagacccatctgta
ttcccaggtacaggaacaccagaaccaggtggaattcagtttaatgagcttctaaattca
atattaaaacttagagggttaaatattgtgggatttgatattaatgaattatcaccacag
tatgaccaaacaggagcatcaacggctgtagcttgtaaagttttaagagagatgttatta
gtagcaaataacaaatag

DBGET integrated database retrieval system