KEGG   Clostridium perfringens SM101: CPR_0518Help
Entry
CPR_0518          CDS       T00379                                 

Definition
copper-translocating P-type ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
cpr  Clostridium perfringens SM101
Brite
Enzymes [BR:cpr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     CPR_0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(613160..615829)
Genome map
AA seq 889 aa AA seqDB search
MSAIIFMINKSIKIKGMSCAACAARIEKVLGKMDGISKANVNLATEKLNLEFDENKISFK
EIEEKINKLGFSVVRNLKKESFKVSGMSCASCAARIEKVLNKLSGIYNATVNFANESLQV
EYDEDEISLEEIKVKVKKLGFELKGNNKSTSFKVEGMTCSACAARIEKVTSKMDGVESSN
VNFANSTLNISFDKDKLSTNDIKAKVEKLGYKLLDASQEDEHEKAKENETKRMKNRLIGS
AIFTIPLFIISMGHMVGLHLPNIIDPMHNPLNFALIQLLLTTVVIFICRDFFIHGFKNLF
MRSPNMDSLIAIGSGAAYVYGLFAIYHIYMGDHSYAMQLYFESAGTILTLISLGKYLETL
TKGKTSDAIKKLMGLAPKTATLLVDGKEKIVSIDDVKVFDLILVKPGEKLPVDGKVVEGY
TSIDESMLTGESIPSEKKVGDTVFGASINKNGRIIYEATKVGKDTVISQIVKLVEDAQGS
KAPIAKLADTISGYFVPIVISLAVVASLAWYFSGESKTFALTIFISVLVIACPCALGLAT
PTAIMVGTGKGAENGILIKSGEALESTQNLNTVVFDKTGTITEGKPKVTDIICENISKDE
LLLLAASAEKGSEHPLGEAIVRDAEEKNLKLKNVLDFEAIPGKGIKCSIEDKRILLGNYK
LMKDKNINLKNLLATSEELASKGKTPMFIAIDEKIAGIIAVADTVKETSKKAIKTLQKMG
LEVVMLTGDNLKTAKAIAKEVGVNRVIAEVLPQEKAEKIKTLQDEGKKVAMVGDGINDAP
ALAISDIGMAIGSGTDIAMESADIVLMKGDILHVVGAIQLSRQTMKNIKENLFWAFGYNT
LGIPVAMGVLHIFGGPLLNPMIGAFAMSFSSVSVLLNALRLKKFKPNYK
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctataatttttatgataaataaatcaattaaaataaaaggtatgagttgtgcc
gcttgtgctgctagaatcgaaaaagttctaggtaaaatggatggcatatcaaaagctaat
gttaatttggcaactgaaaaattaaatttagagtttgatgaaaataaaatatcctttaaa
gaaatagaagaaaaaataaataagctaggtttctcagtagttagaaacttaaagaaagaa
tctttcaaagtttctggaatgagttgtgcttcctgcgcagctagaattgagaaagtttta
aataaattatctggaatatataatgctactgttaactttgctaatgaaagccttcaagtt
gaatatgatgaagatgaaatttccttagaagaaattaaagtaaaagtaaaaaaactaggc
tttgaactaaaaggaaataataagtctacttcctttaaagtagaaggaatgacttgttca
gcctgtgcagctagaattgaaaaagtaacaagtaaaatggatggtgttgaaagttctaat
gttaacttcgcaaattctactcttaatatttctttcgataaagataaactttctactaat
gatataaaagcaaaggtagaaaaattaggatataaacttttagatgcatctcaagaagat
gaacatgaaaaagcaaaagagaatgaaactaaaagaatgaaaaatagacttattggctca
gcaatattcactattccattatttataatatcaatgggacatatggttggtcttcattta
cctaatataatagatccaatgcataatcccttaaactttgcacttattcaattgcttctt
acaactgtagttatattcatatgtagagatttctttatacatggttttaagaatttattt
atgagaagtcctaatatggattccttaatagctataggatctggtgctgcatatgtttat
ggattatttgcaatataccacatttatatgggtgaccatagctatgctatgcagttatat
tttgaatctgctggaacaatacttacattaataagtttaggtaaatacttagagacttta
actaaaggtaaaacttctgatgcaataaaaaaacttatgggattagcccctaaaacagct
actctacttgtagatggcaaagaaaaaattgtttctattgatgatgttaaagtttttgat
ttaatacttgttaagccaggtgaaaaattacctgtagacggtaaagttgtagaaggatat
acatccattgatgaaagtatgctaactggagaaagtattccttctgaaaaaaaagtagga
gatacagtctttggagctagtataaataaaaatggaagaataatttatgaagctacaaag
gtaggtaaagatactgtaatctctcaaatagttaagttagtagaagatgctcaaggatca
aaagctccaattgcaaaattagctgatactatttcaggttatttcgtacctatagtaata
tctttagcagtagttgcaagtttagcttggtatttttctggtgaaagtaaaacttttgca
cttacaatatttatatctgtattagtaatcgcttgtccatgcgctttaggtctagctacc
ccaacagctattatggttggtacaggtaaaggagctgaaaatggaatacttattaaaagt
ggtgaagctttagaaagtacacaaaatttaaatactgttgtcttcgacaaaacaggaact
ataactgaaggaaaacctaaggttacagatattatttgtgaaaatatttcaaaagatgaa
ctccttttattagcagcctcagcagaaaaaggttcagaacatcctcttggagaagctatt
gttagagatgctgaagaaaaaaatctcaaactaaaaaatgttttagattttgaagcaata
cctggtaagggaattaagtgttctattgaagataaaagaattttattaggtaactataaa
cttatgaaagataaaaatataaatcttaaaaatttattggcgacttctgaagaattagct
tcaaagggaaaaactcctatgtttattgctattgatgaaaaaatagctggtataatcgct
gttgctgatactgttaaagaaacaagtaaaaaagctataaaaactctacaaaaaatggga
cttgaagtagtaatgttaacaggagataatttaaaaacagctaaggctattgcaaaagaa
gtaggtgtaaatagagttattgctgaggttcttcctcaagaaaaggcagaaaaaattaaa
actcttcaagatgaaggcaaaaaagtcgctatggttggtgatggaataaatgatgctcct
gctttagctatttctgacattggaatggctataggttcaggtactgatatagctatggag
tctgctgatatagttctaatgaaaggtgatatattacatgttgttggtgctattcaatta
agtaggcaaacaatgaaaaatataaaggaaaacttattctgggcctttggatacaacact
ttaggtattccagtagcaatgggagttcttcatatatttggaggcccattacttaatcca
atgataggtgcctttgccatgagctttagttcagtatcagtattattaaatgccttaaga
ctaaaaaaattcaaaccaaactataaataa

DBGET integrated database retrieval system