KEGG   Clostridium perfringens SM101: CPR_0557Help
Entry
CPR_0557          CDS       T00379                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cpr  Clostridium perfringens SM101
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cpr00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cpr00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:cpr00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
658610..659533
Genome map
AA seq 307 aa AA seqDB search
MDINLDALVEANRKYTKDGHVATYIPALAKVNPNQLGVCIYDLKENKKFSAGEYDVRFAI
ESISKVPTLILAILDNGIEKVFSEVGTEPSGFAFNSIMNMQINHKNKPSNPFINAGAIKV
VSLLKGKNDEERFKRILDFYRKIMNDDEITLDTEIYLSERETGDINRSLAYYMKGNGIME
GDVTDILDSYFKQCSVLVTAEDLARLGAVLANEGVMPWNGERLFSVETATVVKSLMTTYG
LYDESGAFSVHIGLPSKSGVGGGILSSVPNKCGIGLFSPALDVPGNSVTSMKLLKEIADK
LKLDIFR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggatataaatttagatgctttagtagaagcaaatagaaaatatacaaaagatggacat
gtagctacatatattccagcccttgcaaaggtaaatccaaatcaattaggtgtttgtatt
tatgatttaaaagaaaataaaaagttttcagctggagaatatgatgttagatttgcaatt
gaaagcatatcaaaggttcctacattaatattagctatattagataatggaatagaaaaa
gtattttcagaagttggaacagaaccctctggatttgcttttaattcaattatgaatatg
caaataaatcataaaaataaaccatcaaacccatttattaatgcaggagctattaaagta
gtatccttacttaagggaaaaaatgatgaagaacgttttaaaagaattttagatttttat
agaaagattatgaatgatgatgaaattactttagatactgaaatatatttatcagaaaga
gaaacaggtgatataaacagatctcttgcttattatatgaagggtaatggaatcatggaa
ggtgatgttactgatattttggattcatattttaaacaatgttcggttttagttacagct
gaggatttagcaagattaggtgctgtattagctaatgaaggggttatgccttggaatggt
gaaagattattttctgtagaaacagctactgttgttaaatcattaatgactacttatgga
ttatatgatgaatcaggagctttttcagttcatattggactaccatctaaaagtggtgta
ggaggaggaatactatcttcagttcctaataaatgtggtataggattatttagtccagct
ttagatgtaccaggaaatagtgttactagtatgaaacttctaaaggaaatagcggataaa
ttaaaattagatatatttagatag

DBGET integrated database retrieval system