KEGG   Clostridium perfringens SM101: CPR_0815Help
Entry
CPR_0815          CDS       T00379                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cpr  Clostridium perfringens SM101
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CPR_0815
  Lipid metabolism
   00600 Sphingolipid metabolism
    CPR_0815
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CPR_0815
Enzymes [BR:cpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CPR_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
941279..943693
Genome map
AA seq 804 aa AA seqDB search
MRKIIHINDQWFYANDYKGEYLKNEFDFSNFERVDLPHTNIELPYNYFDEKSYQFVSTYV
KTLKFDNSVKGKKVFLDFEGVMIAAEVYLNGIHVGGHKGGYTNFSIDITDALKINEDNIL
KVVVDSTERPDIPPHGYVVDYLTYGGIYREVSLRVVEPIFINNLYARAYDCLKEEKRLEL
YIEINNFEKYRDDLEIVVDFGDDTFEETLSTKLPIEEGTSIKNIEIDQLNMVKLWDIENP
KLYEIKVKLLKGSEVIDEYKDNFGFREAEFRSDGFYLNGRRVKLVGLNRHQAYPYVGYAM
PQRVQEKDAEILKYELGLNIVRTSHYPQSVHFLRKCDEIGLLVFEEIPGWQHIGDEAWQA
ESIKNVEEMIKKDYNRPSIVLWGVRINESQDSHDFYVKTNAMAKSLDPIRQTGGVRYLEN
SDFLEDVYTMNDFIHSGGEKVLRTQSEVTGQVDKVPYLVTEYNGHMYPTKSFDQECKKVE
HAYRHLRVINESFGLDEISGAIGWCAFDYNTHSSFGSGDKICYHGVSDMFRNPKYAAYSY
ASQKKVEDGVVLEPITLGAKGERDGGAILPFTVLTNCDYIKIFKDGIYIDTYYPNKEKFP
NLPHPPIEVSHILSMDSEIPLTEEAKKEIKDFVLNKLKDSNLTNLAEEDFKYIEEFSERV
NIPVFKIMSLVYKLAGGWGDKENSLIIKGFIDNKEVASKEIGELRSMNKLEVTPDNLELS
LDKTSYDATRIVVKLLDNLGEVLFLNNDFIEVEIDGPLSIMGPSKFGISGGAVAFWVRTQ
GKTGLCKIKVKSMYFEEEISIEVK
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaataattcatatcaatgatcaatggttttatgcaaatgattacaaaggtgag
tatttaaaaaatgagtttgattttagtaattttgaaagggtagatttacctcatacaaat
atagagttaccatataattattttgatgagaaatcatatcaatttgtttctacttatgtt
aaaactttaaaatttgataatagtgttaaagggaaaaaggtatttttagattttgaagga
gttatgatagccgcagaagtatatttaaatggaattcatgttggtggacataagggtggt
tacactaatttttcaatagatattactgatgctttaaaaattaatgaagataatatatta
aaggttgttgttgactcaacagaaagaccggatatacctcctcatggatatgttgttgat
tatttaacctatggaggaatatatagagaagtttccttaagagtagttgaacctatattt
ataaataatttatatgcaagggcatatgattgtttaaaggaagaaaaaagattagaactt
tatatagaaataaataattttgaaaaatatagagatgatttagaaattgttgtagacttt
ggtgatgatacttttgaagaaactttaagtacaaagttaccaattgaagaaggaacaagt
attaaaaatatagaaatagaccaattaaatatggttaagttatgggatatagaaaatcct
aagctttatgaaataaaagttaagttattaaaaggttcagaagttatagatgaatataaa
gataattttggatttagagaggctgaatttagatcagatggtttctatttaaatggaaga
agagttaaacttgttggattaaatcgtcatcaggcttatccatatgtaggatatgctatg
cctcaaagagttcaagaaaaggatgctgagattttaaaatatgaattaggactcaacata
gttagaacatctcactatccgcaatcagtacacttcttaagaaaatgtgatgagattgga
ctattagtttttgaagagatacctggttggcaacatataggtgatgaagcttggcaagca
gaatctattaaaaatgtagaggaaatgataaaaaaagattacaatagaccttccatagtt
ttatggggcgttagaataaatgagtctcaagatagtcatgatttttatgtgaaaactaat
gctatggcaaagagtttagatcctattagacaaactggtggggttagatacttagaaaat
agtgatttcctagaagatgtttataccatgaatgattttatacacagtgggggagaaaaa
gtattaagaactcaaagtgaagtaacaggacaagtagataaagttccttatttagtaact
gagtataatgggcatatgtatccaacaaaaagctttgatcaagaatgtaaaaaagttgaa
catgcttatagacatttgagagttattaatgaatcctttggcttagatgaaataagtgga
gccataggatggtgtgcttttgattataatacacatagttcctttggttcaggagataaa
atttgttaccatggagtttctgatatgttcagaaatcctaagtatgcagcttattcctat
gctagccaaaagaaagtagaagatggtgtggttttagaacctattactttaggggctaag
ggagaaagggatggaggagcaatacttccatttacagttcttacaaactgtgattatata
aaaatatttaaagatggaatatatatagatacttattatcctaataaagaaaagttccct
aatttaccacatccaccaatagaggtttcacatattttatctatggattcagaaatacct
cttactgaagaagcaaaaaaagaaattaaagactttgtattaaataaattaaaagattct
aatttaactaatttagctgaagaagattttaaatatattgaagaatttagtgaaagagta
aatatacctgtatttaaaataatgtctttagtttataaattagctggaggttggggagat
aaggaaaactccttaataataaaaggctttatagataataaagaggttgcttctaaagaa
ataggtgaacttagaagcatgaataaacttgaagttacaccagataatttagaactttca
ttagataaaacaagttatgatgctactagaatcgtggttaaacttttagataatttagga
gaggttcttttcttaaataatgattttattgaagtagaaatagatggacctttaagtata
atgggaccaagtaagtttggaatttctggtggagcagtcgctttctgggtaagaactcaa
ggaaaaactgggctttgcaaaataaaggttaagagcatgtactttgaagaagaaatttct
atagaagttaagtag

DBGET integrated database retrieval system