KEGG   Clostridium perfringens SM101: CPR_0867Help
Entry
CPR_0867          CDS       T00379                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cpr  Clostridium perfringens SM101
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CPR_0867
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CPR_0867
Enzymes [BR:cpr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CPR_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1004548..1005027
Genome map
AA seq 159 aa AA seqDB search
MEIYDISVKDINGENVSLEIYRGKVLLIVNTASKCGFTKQFDGLEELYEKYKDEGFEVLG
FPCNQFKEQDPGSNSEIMNFCKLNFGVTFPMFEKIDVNGENESLLYSYLKEQKSGMFGSK
IKWNFTKFLVDREGNVIKRFSPQTTPKSIEKDIEELLAK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttatgatattagcgtaaaagatattaatggagaaaatgtaagtttagaaata
tatagaggaaaggttcttttaatagttaatactgctagtaaatgtggttttacaaaacag
tttgatggattagaagagctttatgaaaaatataaagatgaaggttttgaggttttagga
tttccttgtaatcaatttaaggaacaagatccaggaagcaattcagaaataatgaacttt
tgtaaattaaattttggtgtaacattccctatgtttgaaaaaattgatgttaatggagaa
aatgaatctctattatattcttacttaaaagaacagaaaagtggaatgtttggaagtaaa
attaagtggaattttactaagtttctagtggatagagagggaaatgtaataaagagattt
tcgccacaaacaactccaaaatcaatagaaaaagatattgaggagcttttagctaaatag

DBGET integrated database retrieval system