KEGG   Clostridium perfringens SM101: CPR_0867Help
Entry
CPR_0867          CDS       T00379                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cpr  Clostridium perfringens SM101
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cpr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cpr00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1004548..1005027
Genome map
AA seq 159 aa AA seqDB search
MEIYDISVKDINGENVSLEIYRGKVLLIVNTASKCGFTKQFDGLEELYEKYKDEGFEVLG
FPCNQFKEQDPGSNSEIMNFCKLNFGVTFPMFEKIDVNGENESLLYSYLKEQKSGMFGSK
IKWNFTKFLVDREGNVIKRFSPQTTPKSIEKDIEELLAK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttatgatattagcgtaaaagatattaatggagaaaatgtaagtttagaaata
tatagaggaaaggttcttttaatagttaatactgctagtaaatgtggttttacaaaacag
tttgatggattagaagagctttatgaaaaatataaagatgaaggttttgaggttttagga
tttccttgtaatcaatttaaggaacaagatccaggaagcaattcagaaataatgaacttt
tgtaaattaaattttggtgtaacattccctatgtttgaaaaaattgatgttaatggagaa
aatgaatctctattatattcttacttaaaagaacagaaaagtggaatgtttggaagtaaa
attaagtggaattttactaagtttctagtggatagagagggaaatgtaataaagagattt
tcgccacaaacaactccaaaatcaatagaaaaagatattgaggagcttttagctaaatag

DBGET integrated database retrieval system