KEGG   Clostridium perfringens SM101: CPR_0894Help
Entry
CPR_0894          CDS       T00379                                 

Definition
(GenBank) putative membrane protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1028752..1029573
Genome map
AA seq 273 aa AA seqDB search
MNNNLRFILKTTGIHILTYILCGIIFSTIFSYNSLFSMNGVEEFMKGVGGVSTLLGPLVQ
VIRGILFGLVLLLFKDTFIGKKYGWLKLWAILSIIGIINTPAPAPFSIEGIVYTKLPLEF
HLKVAPEILIQTLLFSYLLAKQSKKRNIKFIEDNKNEFVSAIVCMVLFSLSGIVLAFIKG
IDIKSSVGDMGAFGVMFIASVSTFFISKYYAKIESKLKDIIAVISLYFLLGILPYIYNLI
TNSPFNTNLTLLINIIPTAIVLWVIKLNCKNKK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaatctaaggtttatattaaaaacaacaggaatacatattttgacctatatt
ttatgtggaataattttttctaccatatttagttataatagcttattttctatgaatggg
gtagaggaattcatgaaaggtgttggaggggtaagcaccttattaggacctttagtacag
gttattcgtggaattttatttggattagtgttactactatttaaagatacttttatagga
aaaaaatatggatggttaaaattgtgggctatattaagtataataggaataataaataca
ccagcaccagctcccttttcaatagaaggtatagtgtacaccaagttaccattagagttt
catttaaaagtagcaccagaaattcttattcaaacattactattttcatatctattagca
aagcaatctaaaaagagaaatataaaatttattgaagataacaaaaatgaatttgtttct
gcaatagtttgtatggtgcttttttctttatcaggtatagtactagcatttataaaagga
atagatattaaatcctcagtaggtgatatgggagcttttggagtgatgtttatagcttca
gtatctacattttttatctctaaatattatgccaaaatagaaagtaaattaaaggatatt
atagccgtaattagtttatattttttattaggaattttgccatatatatataatttaata
actaattctccttttaatactaatttaactttattaataaatataatacctactgcaata
gttttatgggttataaagttaaattgtaagaataaaaaataa

DBGET integrated database retrieval system