KEGG   Clostridium perfringens SM101: CPR_0921Help
Entry
CPR_0921          CDS       T00379                                 

Definition
(GenBank) hypothetical protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_VII_L
Motif
Other DBs
NCBI-ProteinID: ABG87443
UniProt: Q0SUG2
Position
1051384..1052328
Genome map
AA seq 314 aa AA seqDB search
MDISIQGTYESMGLEPYTDYCFLNTVMDDRGILVKLRNGKYLSNSFDKVAKALKSQGNSF
REGKTIQVYNEKLLEEYRNLKGLKDKIDEFSRGKLKEVLNLIKLRKKTLSSKKKELKDNK
EKLELIKKREIQIKNLEKRLKSEFDDYKEKNYNEPYSKFASLTTSLKYYETLYNVKLIIH
VRCEDENTLLDIKENIYNLKSIGRSEDFVDIKEVKIVDLVEEGKELKRRIVNINSAYVDY
NLVKGKIIRSRNLSDSKECNGTKYLLNKNYEILDKKRVFKKKKVVYLSNYVVRKKVDNVY
YDLGEEESYIVNFI
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacataagcatacagggaacttatgaatcaatgggattagaaccatatactgattac
tgtttcttaaatactgtcatggatgacagaggaatattagttaaactaagaaatggaaaa
tatttatctaattcctttgataaagttgcaaaggctttaaaatctcaaggcaatagtttt
agagagggcaaaactattcaagtttataatgagaagttattagaagaatatagaaactta
aagggtttaaaagataaaatagacgagtttagcagaggtaagcttaaagaagttttaaac
ttaataaagcttagaaaaaagacattatcatctaaaaagaaagaactaaaggacaataaa
gaaaagcttgaattaattaaaaagagagaaattcaaataaagaatttagaaaaaagatta
aaaagtgagtttgatgattataaagagaaaaattataatgaaccttactcaaaatttgct
agtttaacaacttcactaaaatattatgaaactttatataatgtaaagttaattattcat
gtaagatgtgaggatgaaaatactttattagatataaaagaaaatatatacaacctaaaa
tcaataggtagaagtgaagactttgttgatataaaggaagttaaaatagtagatttagtg
gaagagggaaaagagctgaaacgcaggatagtaaacataaattcagcatatgtagattat
aacctagttaaaggaaagataattcgttctagaaacttaagtgatagtaaagaatgtaat
ggaactaaatatttacttaataaaaattatgaaatattggataaaaagagggtatttaaa
aagaaaaaagtcgtatatttatcaaactatgttgttagaaaaaaagttgataatgtatat
tatgatttgggagaagaagagagttacattgttaactttatttaa

DBGET integrated database retrieval system