KEGG   Clostridium perfringens SM101: CPR_0922Help
Entry
CPR_0922          CDS       T00379                                 

Gene name
cas3
Definition
(GenBank) CRISPR-associated helicase Cas3 domain protein
  KO
K07012  
CRISPR-associated endonuclease/helicase Cas3 [EC:3.1.-.- 3.6.4.-]
Organism
cpr  Clostridium perfringens SM101
Brite
Enzymes [BR:cpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     CPR_0922 (cas3)
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     CPR_0922 (cas3)
Prokaryotic defense system [BR:cpr02048]
 CRISPR-Cas system
  Type I CRISPR-Cas system
   Type I signiture cas proteins
    CPR_0922 (cas3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1052341..1054551
Genome map
AA seq 736 aa AA seqDB search
MDLSKFTAKLYKIIKEDKIIKENKTVREHTNDLLNNLEFLNDLGYINKESIYNLTKIACE
YHDYGKVNREFQNRIKNETKFNEKKEIAHNVLSLYFINPDDFEEEKDYYRVCFAVLYHHY
YCDGLKVLSEKTDLIENLLSEFETYELDEFTPMEIGDIKSDDEAILIKGFLNKCDFSASG
NTEIEYKNNFLEESLERLLNSWKIDNKEAKWNELQQFAKNNRDNNIMVVAQTGMGKTEAG
LHWIGNNKGFFILPLKTAINAIYDRVSNGIVKENNNEEKHKVALIHSDSLSYYISQNEDT
NIVLDHHREGKQLSIPISIATLDQIFDFVFKYKGYEVKLATLSYSKVVIDEIQMYSADLL
AYLILGIKTIIRLGGKVAILTATLAPFVKDLLLEDNNKLGFVEGTFVNELKRHNLKIYDD
KINADVIYNKYIDNKEKKISNKILVVCNTIKKAQEIYNELKDKNIDNLNILHSKFIKRDR
AYKEEQILEFGKTNNIGDGIWISTQIVEASLDIDFDYLFTELSDINALFQRLGRCNRKGV
KPAYDYNCYVFLQIERNLLTNGDKGFIDKKIYELSKEALRNVDGLLSEEEKVNIINRTLT
TENIKGSDYWSKYTEFFDYVSGLNPYEVDKKDVKLRNIISFDIIPQCIYEKNESEIESLL
EIINDEKTDKINRIKSIDKIKSFTVSVGQYDIELLKNKLIMELEVGKYERIPVYKCNYSE
LGFTRNTKEDVYDNFI
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggatttaagtaagtttactgcaaaattatataaaattattaaagaagataaaattatt
aaagaaaataaaactgttagagagcacacaaatgatttattaaataacttagaattttta
aatgatttaggatatataaataaagaatctatatataatttaactaaaattgcatgtgaa
tatcatgattatggaaaggttaatagggagttccaaaatagaataaaaaatgaaacaaaa
tttaatgagaaaaaagagatagcacacaatgtgctttctctttactttataaacccagat
gactttgaagaggaaaaagattactatagagtatgttttgctgtattatatcatcattat
tattgtgatggacttaaagttttaagtgaaaaaactgatttgatagaaaatttattaagt
gaatttgaaacttatgaacttgatgagtttactcctatggaaataggtgatataaagagt
gatgatgaagctattttaataaaaggcttcttaaataaatgtgattttagtgcaagtgga
aatactgaaatagagtataaaaataatttcttagaagaaagtttagagagactattaaat
tcttggaagatagataataaagaggctaaatggaatgaacttcaacagtttgctaagaat
aatagagataataatataatggttgttgcccaaactggaatgggtaaaactgaagcaggt
ttgcattggattggaaataataaaggtttttttattcttccattaaagacagccataaat
gctatatatgatagagtatctaatggtatagtaaaagaaaataacaatgaagaaaagcat
aaagttgcattaattcattcagattctttatcatattacatttctcaaaatgaagataca
aacatagtattagatcatcatagagaaggaaaacaactatctattcctattagcatagca
accttagatcaaatatttgattttgtatttaagtacaagggctatgaagtgaaattagct
actttatcatattcaaaagtggtaatagatgaaatacagatgtatagcgctgatttatta
gcctacttaatattaggaataaaaaccataataaggctaggaggaaaagttgcaatttta
acagctaccttagctccctttgttaaagatttattattagaagataataataaattaggc
tttgtagaaggtacatttgtaaatgaattaaaaaggcataatttaaaaatatatgatgac
aagataaatgcagatgtaatttataataagtatattgataataaagagaagaaaataagc
aataaaatattagttgtatgcaatacgataaaaaaggctcaagaaatttacaatgaacta
aaagataaaaatatagataatttaaatattttacatagtaaatttataaaaagagacaga
gcttataaagaagagcaaatattagagtttgggaaaactaataatattggagatggcata
tggatatcaactcagattgtagaagctagtttagatattgattttgactatttatttaca
gaactatcagatataaatgctttattccaaagacttggtagatgtaatagaaaaggggtt
aagcctgcttatgactataactgttatgttttcttacaaatagagagaaatttattaact
aatggagataaggggtttatagataaaaaaatatatgaattatcaaaagaagcattaaga
aacgtagatggtcttttatcagaagaggaaaaagtaaatattataaatagaacattaacc
actgagaatataaagggaagtgattattggtcaaaatacacagaattttttgattatgtt
agtggacttaatccatatgaagtagacaagaaagatgttaaacttagaaatataatatct
tttgatataatacctcaatgtatttatgagaaaaatgaatcagaaattgaaagcttactt
gaaattataaatgatgaaaaaacagataaaataaatagaataaaatccatagataaaata
aaaagttttacagtatcagttgggcaatatgatattgaacttttaaaaaataaacttatt
atggagttagaagtaggaaagtatgaaagaattccagtatataaatgcaattattcagag
ttaggatttactagaaacactaaagaagatgtatatgataatttcatataa

DBGET integrated database retrieval system