KEGG   Clostridium perfringens SM101: CPR_0941Help
Entry
CPR_0941          CDS       T00379                                 

Definition
(GenBank) Resolvase, N terminal domain family
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Resolvase MerR MerR_1 HTH_17 DUF4434 Glyco_hydro_97 DUF4131
Motif
Other DBs
NCBI-ProteinID: ABG87183
UniProt: Q0SUE2
Position
complement(1074619..1075245)
Genome map
AA seq 208 aa AA seqDB search
MSKHYKPKEFAELLNVSVITLQRWDNDGKLKAFRTPTNRRYYTYEQYLEYIGIHKETDSR
KIVIYTRVSTSNQKDDLKNQVEFLRQYANAKGIIVDEIIEDYGSGLNYNRKKWNKLIDSC
MTNEISTIIITHKDRFIRFGYDWFESFLAKFNVKIIVVNNESLSPQKELVQDIISILDTF
SCRIYGLRKYKKKIRDDEEVEKSIKDRN
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacattataagcctaaagaatttgcagaattattaaatgtatcagttattaca
ctgcaaagatgggataatgacggaaaattaaaggcatttagaactcctacaaatagaaga
tactacacttatgaacagtatcttgagtatataggaatacataaagaaacagatagcaga
aaaatagttatttatacacgagtttcaacttctaatcagaaagatgacttgaaaaatcaa
gttgaatttcttagacaatacgctaatgctaaaggaataatagtagatgaaatcatagag
gattatggaagtggactaaattataatcgtaaaaaatggaataaacttattgatagttgt
atgacaaatgagataagtacaattatcataactcataaggatagatttattcggtttgga
tatgattggtttgaaagttttttagctaaattcaatgtaaagattatagttgtaaataat
gaaagtctttcaccacaaaaagaattagtccaagatataatatcaatacttgatactttt
agttgtcgcatatatggattaagaaaatataagaaaaaaattagagatgatgaagaagtt
gaaaagagcataaaagatagaaattaa

DBGET integrated database retrieval system