KEGG   Clostridium perfringens SM101: CPR_0943Help
Entry
CPR_0943          CDS       T00379                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-C4H2 Atg14 SKA1 TAF4 DUF5469 ADIP Halogen_Hydrol DUF2347 FapA DUF724 ALMT Wzy_C DDHD DUF4407 Mnd1 Jnk-SapK_ap_N CCDC106 PA26 AAA_13 IncA LMBR1 DUF4175 Presenilin FemAB Allexi_40kDa Golgin_A5 OmpH Muted DUF4692 Hid1
Motif
Other DBs
NCBI-ProteinID: ABG87360
UniProt: Q0SUE0
Position
complement(1076002..1076610)
Genome map
AA seq 202 aa AA seqDB search
MNKFTSFLKKRKAFVIVALIGMIFGFTFFSAPQKDINKLKAEKTTVLAKIDSSQEELSTL
NKDIGDLKEKINQLNDEKQKQEQLLKDTTAKVELKQKEEAEKQRQAEIEKQKQEEANSIS
QSSSNNSSKKSTSNNSSNAKSSSYNSDNPQPSKPVGEMVYITATGKKYHRKNKCGNTNPA
RTSYIPLSEAESMGYSPCSKCY
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttacatcatttttaaagaaaagaaaagcttttgttatagtagctttaatt
ggtatgatttttggttttactttttttagtgcgcctcaaaaagatattaataaattaaag
gcggaaaaaactactgtattagcaaaaatagatagctcgcaagaagaactatctaccttg
aataaagatataggtgatttgaaggaaaaaataaatcaacttaatgatgaaaaacaaaaa
caggaacaacttttaaaagataccacagccaaagtagaactaaaacaaaaagaagaagct
gaaaaacaaagacaagctgagattgaaaaacaaaaacaagaagaagcaaatagtattagt
caaagttcttcaaataattctagtaaaaagtctactagtaataactcatctaacgctaaa
tcaagctcatataattctgataatccacagccttctaaaccagttggtgagatggtgtac
ataactgcaacaggtaaaaaatatcatcgtaaaaataaatgtggtaatacaaacccagct
aggacaagttatattccactatcagaagcagaatctatgggatactccccttgttcaaaa
tgttattaa

DBGET integrated database retrieval system