KEGG   Clostridium perfringens SM101: CPR_0994Help
Entry
CPR_0994          CDS       T00379                                 

Definition
(GenBank) DedA family protein
  KO
K03975  
membrane-associated protein
Organism
cpr  Clostridium perfringens SM101
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1135044..1135688)
Genome map
AA seq 214 aa AA seqDB search
MNLISNFFDLILHLDKYLGVFINNYGTLTYLVLFLIILAETGLVVTPFLPGDSVIFASAT
FCALGMINIYILVPLLLIAAILGDTLNYSIGKFLGSKLLANSKLIKKEYIEKTNTYYDKY
GGKTLIIARFIPIIRTFAPFVAGIGTMKYKNFLTYNAVGGFIWVILVSSLGYFFGNIKIV
AENFSIVIIGIIVVSILPAIVGILKAKFSPKAAM
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgataagtaatttttttgatctaatattacatttagataaatatctaggtgtt
tttatcaataattatggaactttgacttacttagttttatttttaataatccttgcggaa
acaggattagtagtaactccttttcttcctggagattcagtaatatttgcatcagctact
ttctgcgctttaggtatgattaatatttacatattagtaccattattattaattgcagcc
atacttggagatactttaaactatagtattggtaaatttttaggtagcaaattacttgct
aattctaagcttataaaaaaagagtatattgagaaaactaatacttattatgataaatat
ggtggaaaaaccttaataatagctagatttattcctataatccgtacctttgcacccttt
gttgcaggtataggaacaatgaagtataaaaactttttaacttacaatgcagttggtgga
tttatttgggttatacttgtatcaagtttaggatatttctttgggaatataaaaattgtt
gctgaaaatttctcaatagttattataggtataatagttgtttctatcttacctgctata
gtaggaatacttaaagctaaattctcacctaaagctgctatgtaa

DBGET integrated database retrieval system