KEGG   Clostridium perfringens SM101: CPR_1098Help
Entry
CPR_1098          CDS       T00379                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cpr  Clostridium perfringens SM101
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1242810..1243619
Genome map
AA seq 269 aa AA seqDB search
MKIGNKEFEIGKRTYIMGILNVTPDSFSDGGKYNDIELALKRAEKMINDGVDIIDIGGES
TRPTHTPVGEEEELNRVVPVIKALREKFDIPISVDTYKGKVAEEAIKAGADLINDVWGFK
KDKYMATVAAKYGVPCCIMHNRNDNEYGDDIIETMKSDMEESIKIALDAGVKKENIILDP
GIGFAKDYDQNLEVLNRLDEFCNMDYPVLLGTSRKSVIGNTLNLPTDERLEGTLATTTLG
IIKGCEFVRVHDVLENKRTALMTDAMVRR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataggaaataaagagtttgaaataggcaaaagaacatatataatgggaatttta
aatgtgactccagattcattttcagatggtggaaaatataatgatattgagttagctcta
aagagagctgagaagatgattaatgatggcgttgacataatagatattggaggagagtca
acaagaccaactcatacaccagtaggagaagaagaagaattaaatagagtagtacctgta
ataaaagccttaagagaaaagtttgatatacctatatcagttgatacatataaggggaaa
gtggcagaggaagctataaaagcaggtgcagatttaataaatgatgtatggggctttaaa
aaggataaatatatggctactgtggctgctaaatacggagtaccttgttgcataatgcac
aatagaaatgataatgaatatggtgatgacatcatagaaactatgaaatctgatatggaa
gaatctataaagatagccctagatgctggagttaagaaagaaaatataattttagaccca
ggtataggttttgcaaaggattatgatcaaaacttagaagtattaaatagactagatgag
ttttgcaatatggactatccagttctattaggaacatcaagaaaatcagtaataggcaat
actttaaatcttccaacagatgaaagattagaaggtactttagctacaactactcttgga
ataattaaagggtgcgaatttgtaagagttcatgatgttttagaaaataagagaactgcc
cttatgactgatgctatggtaagaagatag

DBGET integrated database retrieval system