KEGG   Clostridium perfringens SM101: CPR_1099Help
Entry
CPR_1099          CDS       T00379                                 

Gene name
folBK
Definition
dihydroneopterin aldolase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3 4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
cpr  Clostridium perfringens SM101
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CPR_1099 (folBK)
Enzymes [BR:cpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CPR_1099 (folBK)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     CPR_1099 (folBK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
1243632..1244453
Genome map
AA seq 273 aa AA seqDB search
MDKIIIKDFEVFGNHGVFKEEKRLGQKFVLSIELFLDTREAGVTGDLSKSVHYGELAHKV
EEEFKKQSYDLIETAAEKLCEFILLEYPLVKKVKVSLKKPWAPILRSLDTVSIEIERGWN
EAYLSYGSNIGDKKYYIEEALKEINKAYHTEIIKKSNLIETEPWGYTEQDEFLNGACKIK
TLLNPKELIKFLLSIEQKLKRERKIKWGPRTIDLDVIFFNDLISEDEEIILPHPRMHERS
FVLEPLNEIAPYKIHPLYRKRVFELLEELNKNK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattattattaaagattttgaggtttttggtaatcatggagtctttaaagag
gaaaaaagacttggacaaaaatttgttttaagcatagaacttttcttagatactagagag
gctggagttactggggatttaagtaaatctgttcattatggagaacttgcacataaggtt
gaggaagagtttaaaaagcaaagctatgatttaatagaaactgcagcagaaaaattatgt
gagtttatattattagaatatcctcttgtaaaaaaagtgaaagtttctttaaagaaacca
tgggcacctatattaagaagtttagatactgtatctatagaaatagagagaggatggaat
gaggcatacctttcatatggttctaatataggagataaaaaatattatatagaagaagct
ttaaaggaaataaataaggcttatcatactgaaattataaaaaaatctaatttaattgag
acagaaccttggggatatactgagcaggatgaatttttaaatggtgcttgtaaaataaaa
actcttttaaaccctaaggaattaataaaatttttattaagtatagaacaaaagcttaaa
agagagagaaagattaagtggggtcctagaactatagacttagatgtaatattttttaat
gatttaataagtgaagatgaagagatcatactgccacatcctagaatgcatgaaagaagt
tttgttttagagccattaaatgaaattgctccttataagattcatcccttatatagaaag
cgtgtatttgaacttttagaagaattaaataaaaataaataa

DBGET integrated database retrieval system