KEGG   Clostridium perfringens SM101: CPR_1203Help
Entry
CPR_1203          CDS       T00379                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpr  Clostridium perfringens SM101
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPR_1203
   01230 Biosynthesis of amino acids
    CPR_1203
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPR_1203
   00030 Pentose phosphate pathway
    CPR_1203
   00051 Fructose and mannose metabolism
    CPR_1203
   00052 Galactose metabolism
    CPR_1203
  Energy metabolism
   00680 Methane metabolism
    CPR_1203
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CPR_1203
Enzymes [BR:cpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CPR_1203
Protein phosphatases and associated proteins [BR:cpr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CPR_1203
Messenger RNA biogenesis [BR:cpr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CPR_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1348851..1349951)
Genome map
AA seq 366 aa AA seqDB search
MMQPIKKIAILTGGGDCPGLNAVIRAVTRTAILKYGYEVIGYKFGYRGLYNNDFVKLDLD
SVSGILHRGGTILHSSNKDNLFDYQVEDENGKIVKKDVSDVGVENLKKEEVDALVVIGGD
GTLTSARDFSRKGVNVIGVPKTIDNDLLATDVTFGFNTATEIATEALDRLHTTAESHHRI
MLLEVMGRNAGWIALESGIAGSADVILLPEIPYDINKIVEKVKEREESGKQFTIIVVAEG
AKPKDGEVVVSKIVDDSPDPVRLGGIANKLAMDLEGLIKNHEIRSTVLGHIQRGGNTSTY
DRILSTKYGVKAVELINSNLFGNMVALKGNKVSYESLENVIGNTKNVDPEGELVNTAKSI
GISFAD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaccaattaagaaaatagctatattaaccggaggaggcgattgtcctggatta
aatgcagtaataagagctgtaactagaactgcaatcttaaaatatgggtatgaagttata
ggttataaatttggatatagaggtctatataataatgactttgtaaaattggatcttgat
tctgtttctggaatacttcatagaggaggaacaatacttcatagctcaaataaggacaac
ctatttgattatcaagttgaagatgagaatggtaaaatagtaaaaaaagacgtttctgat
gttggtgttgaaaacttaaagaaagaagaagtagatgctctagttgttattgggggagat
ggaacattaacctctgcaagagatttttcgagaaaaggcgtaaatgtaataggtgttcct
aaaacaatagataacgatttattagccacagatgtaacttttggatttaatactgccaca
gaaatagctacagaggctttagatagacttcatactacagctgagtcacatcatagaata
atgcttttagaagttatgggaagaaacgctggttggattgctttagaatcaggaatagct
ggttctgctgatgtaatattattacctgaaataccttacgatataaacaaaatagttgaa
aaagtaaaagaaagagaagagtctggaaaacagtttacaattattgtagttgcagaagga
gcaaaacctaaagatggagaagtagttgtttctaaaatagttgatgatagtccagaccca
gtaagactagggggaatagctaacaaattagctatggatttagagggattaataaagaat
catgaaataagaagcactgtgcttggacatatacaaagagggggaaacacctctacttat
gatagaatactttcaactaaatatggagttaaagctgttgaacttataaatagtaattta
tttggaaatatggttgcattaaaaggaaataaagtatcctatgaaagtttagaaaatgta
attggaaatactaaaaatgtagatccagaaggtgaattggtaaacactgctaaaagtata
gggattagtttcgctgattaa

DBGET integrated database retrieval system