KEGG   Clostridium perfringens SM101: CPR_1299Help
Entry
CPR_1299          CDS       T00379                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpr  Clostridium perfringens SM101
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPR_1299 (tpiA)
   01230 Biosynthesis of amino acids
    CPR_1299 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPR_1299 (tpiA)
   00051 Fructose and mannose metabolism
    CPR_1299 (tpiA)
   00562 Inositol phosphate metabolism
    CPR_1299 (tpiA)
Enzymes [BR:cpr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CPR_1299 (tpiA)
Exosome [BR:cpr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CPR_1299 (tpiA)
  Exosomal proteins of bladder cancer cells
   CPR_1299 (tpiA)
  Exosomal proteins of melanoma cells
   CPR_1299 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1469296..1470042)
Genome map
AA seq 248 aa AA seqDB search
MRTPIIAGNWKMHYTIDEAVKLVEELKPLVKDAKCEVVVCPTFVCLDAVKKAVEGTNIKV
GAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAHNL
TPILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKTATSD
QANETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLVAA
DFAQIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaactccaataatcgcaggaaactggaaaatgcactatacaatagatgaggctgtt
aaattagttgaagaattaaagccattagttaaagatgctaaatgtgaagttgttgtttgc
ccaacttttgtttgcttagatgcagttaaaaaagctgttgaaggaacaaacataaaagta
ggtgctcaaaacatgcactttgaagaaaaaggagcattcactggagaaatcgctccaaga
atgttagaagctatgaacatagattatgttataattggacatagtgaaagaagagaatac
ttcaacgaaacagatgaaacttgcaacaaaaaagttaaagctgctttcgcacacaactta
actccaatcctttgctgtggagaaactttagagcaaagagaaaacggaactactaatgac
gttataaaagctcaaataactgctgatttagaaggattaactaaagagcaagctgagaaa
gttgttatagcttacgaaccaatctgggctataggaactggaaaaactgctacttcagac
caagctaatgaaacaatagctgctataagagctatggttgctgaaatgttcggacaagaa
gttgctgataaagtaagaatccaatacggtggatcagttaagcctaatacaatagcagag
caaatggctaaatcagacatcgatggtgctttagttggtggagctagcttagttgcagct
gactttgctcaaatcgtaaactactaa

DBGET integrated database retrieval system