KEGG   Clostridium perfringens SM101: CPR_1421Help
Entry
CPR_1421          CDS       T00379                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III methyltransferase/synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr00860  Porphyrin and chlorophyll metabolism
cpr01100  Metabolic pathways
cpr01110  Biosynthesis of secondary metabolites
cpr01120  Microbial metabolism in diverse environments
Module
cpr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPR_1421 (hemD)
Enzymes [BR:cpr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CPR_1421 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CPR_1421 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: ABG87741
UniProt: Q0ST17
Position
complement(1600005..1601483)
Genome map
AA seq 492 aa AA seqDB search
MSKKAYIIGAGPGDEELLTLKAINALQKCTAVLYDRLVGNNILNYLNDDCEIYYCGKEPG
CHYKTQEEINESIVELAKKGHIVGRVKGGDPYVFGRGGEEVLALVEENIPFEVIPGVTSP
ISVLNYAGIPITHRGLAQSFHIVTGMSARTLNVNWKALSKENGTLVFMMGLSNLETIVEK
LLENGKDIETPCGVVMRGTTSKQRKVIGTLENICKKVREAKLESPCIIVVGDVVSLNEKL
SWYEKLPLFGANICLTRSKEQSKEIKWKLKELGAEVTEINSIKIKETSENLDEYINTLEK
YDHIVFTSVNAVNVFFDYLVKKRVDIRKIKADFAVLGKATKKALIARGIVPSIMAHSFTA
EGLFEVLKDNIKEGEEVLIPCSSLSREYLFDNLASLGAKCHRVNIYDTICGDVKNPRAFK
EVDMVLYTSPSTVKNMIDMIGLESLKEKVSIAIGPITLKALNESGIEGKMCKTHCGDGFL
SEIEGIWQEVKK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagcatatataataggggcaggtcctggagatgaagagttattaacactt
aaagcaataaatgcattacaaaaatgcacagctgtcttatatgatagattagttggaaac
aatatacttaattacttaaatgatgactgtgagatttactattgtggaaaagagccagga
tgtcattataaaacacaggaagagataaatgaaagtatagttgaacttgctaaaaaaggt
catattgttggtagagtaaaaggtggagatccctatgtttttggaagaggtggagaagaa
gtattagccttagtagaagaaaacataccttttgaagttattccaggggttacttcacct
atttctgttttaaattatgcagggataccaataacacatagaggattagcacagagtttt
catattgtaacaggaatgtcagcaagaactttaaatgtaaattggaaagctttatcaaaa
gaaaatggaaccttagtatttatgatggggctttcaaatttagagacaattgttgagaaa
cttttagaaaatggtaaagatatagaaactccttgtggagtagtaatgagaggaacaact
tcaaagcaaagaaaggttattggaacattagaaaatatatgtaaaaaggttagagaagct
aagttagagtcaccttgtataatagttgttggtgatgttgtttcattaaatgaaaaactt
tcatggtatgaaaaattacctctatttggagctaatatttgtttaacaagatctaaggaa
caatctaaagagattaagtggaaattaaaagagttaggtgcagaagtaacagaaataaac
tctataaaaataaaagaaacttcagaaaatttagatgaatatattaatactttagaaaaa
tatgatcatatagtatttacttcagtaaatgctgttaatgtattctttgattatttagtg
aaaaaaagagttgatataagaaaaataaaagcagattttgctgtactaggaaaagcaact
aaaaaagctttaatagctagaggaattgtaccaagcataatggctcattcatttacagcg
gaaggtttatttgaagttttaaaagataatattaaagaaggagaagaagtcttaattcca
tgctcttctttaagtagagaatatttgtttgataatttagcttctttaggagcaaaatgt
catagagttaatatttatgatactatatgcggagatgttaaaaatccaagagctttcaag
gaagttgatatggtattatacacaagtccttcaacggttaaaaacatgattgatatgatt
ggacttgaatctcttaaagagaaagtaagtatagctataggacctataaccttaaaagct
ttaaatgaaagtggaattgaagggaaaatgtgcaaaacacattgtggggatggattttta
agtgaaattgaaggtatatggcaagaggttaaaaaataa

DBGET integrated database retrieval system