KEGG   Clostridium perfringens SM101: CPR_1421Help
Entry
CPR_1421          CDS       T00379                                 

Gene name
hemD
Definition
uroporphyrinogen-III methyltransferase/synthase (EC:4.2.1.75 2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cpr  Clostridium perfringens SM101
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cpr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(1600005..1601483)
Genome map
AA seq 492 aa AA seqDB search
MSKKAYIIGAGPGDEELLTLKAINALQKCTAVLYDRLVGNNILNYLNDDCEIYYCGKEPG
CHYKTQEEINESIVELAKKGHIVGRVKGGDPYVFGRGGEEVLALVEENIPFEVIPGVTSP
ISVLNYAGIPITHRGLAQSFHIVTGMSARTLNVNWKALSKENGTLVFMMGLSNLETIVEK
LLENGKDIETPCGVVMRGTTSKQRKVIGTLENICKKVREAKLESPCIIVVGDVVSLNEKL
SWYEKLPLFGANICLTRSKEQSKEIKWKLKELGAEVTEINSIKIKETSENLDEYINTLEK
YDHIVFTSVNAVNVFFDYLVKKRVDIRKIKADFAVLGKATKKALIARGIVPSIMAHSFTA
EGLFEVLKDNIKEGEEVLIPCSSLSREYLFDNLASLGAKCHRVNIYDTICGDVKNPRAFK
EVDMVLYTSPSTVKNMIDMIGLESLKEKVSIAIGPITLKALNESGIEGKMCKTHCGDGFL
SEIEGIWQEVKK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagcatatataataggggcaggtcctggagatgaagagttattaacactt
aaagcaataaatgcattacaaaaatgcacagctgtcttatatgatagattagttggaaac
aatatacttaattacttaaatgatgactgtgagatttactattgtggaaaagagccagga
tgtcattataaaacacaggaagagataaatgaaagtatagttgaacttgctaaaaaaggt
catattgttggtagagtaaaaggtggagatccctatgtttttggaagaggtggagaagaa
gtattagccttagtagaagaaaacataccttttgaagttattccaggggttacttcacct
atttctgttttaaattatgcagggataccaataacacatagaggattagcacagagtttt
catattgtaacaggaatgtcagcaagaactttaaatgtaaattggaaagctttatcaaaa
gaaaatggaaccttagtatttatgatggggctttcaaatttagagacaattgttgagaaa
cttttagaaaatggtaaagatatagaaactccttgtggagtagtaatgagaggaacaact
tcaaagcaaagaaaggttattggaacattagaaaatatatgtaaaaaggttagagaagct
aagttagagtcaccttgtataatagttgttggtgatgttgtttcattaaatgaaaaactt
tcatggtatgaaaaattacctctatttggagctaatatttgtttaacaagatctaaggaa
caatctaaagagattaagtggaaattaaaagagttaggtgcagaagtaacagaaataaac
tctataaaaataaaagaaacttcagaaaatttagatgaatatattaatactttagaaaaa
tatgatcatatagtatttacttcagtaaatgctgttaatgtattctttgattatttagtg
aaaaaaagagttgatataagaaaaataaaagcagattttgctgtactaggaaaagcaact
aaaaaagctttaatagctagaggaattgtaccaagcataatggctcattcatttacagcg
gaaggtttatttgaagttttaaaagataatattaaagaaggagaagaagtcttaattcca
tgctcttctttaagtagagaatatttgtttgataatttagcttctttaggagcaaaatgt
catagagttaatatttatgatactatatgcggagatgttaaaaatccaagagctttcaag
gaagttgatatggtattatacacaagtccttcaacggttaaaaacatgattgatatgatt
ggacttgaatctcttaaagagaaagtaagtatagctataggacctataaccttaaaagct
ttaaatgaaagtggaattgaagggaaaatgtgcaaaacacattgtggggatggattttta
agtgaaattgaaggtatatggcaagaggttaaaaaataa

DBGET integrated database retrieval system