KEGG   Clostridium perfringens SM101: CPR_2143Help
Entry
CPR_2143          CDS       T00379                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpr  Clostridium perfringens SM101
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPR_2143
Enzymes [BR:cpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CPR_2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2375503..2377737)
Genome map
AA seq 744 aa AA seqDB search
MEVLNGIVESIVFKSSDTGYTVIKFRENNIIHTAVGVLPHVKEGQNLKITGSWVNHSQFG
KQFKVEECEEILPTSKDGIEKYLSSGIIQGIGPVTAKKIVNKFGEDTLNILDNNIERLKE
IEGIGKKKLETIIESYREQRELKNITIFLQTHGLSVNQCLKIYKKYGASSVDTVKNNPYI
LCDEISGIGFKTSDKIARSLGIEIDSPFRIQSGIRYVINEFCTNGHTFMPKDELIKEASN
VLTVSEDIIEENIKNAALDRKIKLEKVNDKEGVFTIPNYYCELGITNRILTLAISNFQDI
SVDVDHLILQFEKKNNITFAESQKDAIISAFQNGIEIITGGPGTGKTTIIKCIIEIFETC
GLKVLLGAPTGRAAKRMSESTGKEATTIHRMLDMGVFEKEESVFVTNAEEHSLEADVVII
DEASMIDITLMNALLKSIKVGTRLIIVGDVDQLPSVGAGNVLNDFIESGFTKVVRLKEIF
RQGKESMIVVNAHKINKGEMPKLNEKGTDFFFIRNDIQEGILNTIIDLINTRLPRFNSNW
DKLKSIQVLVPMKKGVLGVTNLNERIQNVLNPKAPYKKEKEFRSMVFREGDKVMQIKNNY
SLKWTRIAGKGDHEGLGVFNGDMGFIESIDLEGKKLSIIFDDERRVIYDFIYLDELDLAY
AITIHKSQGSEFPVVIIPAYMGAPLLMNRNLLYTGITRAKEMVVVVGIPKALKYMVDNTR
SMERYSSLNWRIKEVISNEVFEQD
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggaagtattaaatggaatagttgagagtatagtatttaaaagttcggatacagggtat
acagttataaaatttagagaaaataatattattcatacagcagtgggagttttaccacat
gtaaaagaaggtcaaaatttaaaaattaccggaagttgggttaaccattcacagtttgga
aaacaatttaaagtagaagaatgtgaagagatattacctacttcaaaggatggaatagaa
aaatatttatcttctgggataatacaggggataggacctgttacggcaaaaaaaattgta
aataaatttggagaagatactcttaatattttagataataatattgagagattaaaagaa
atagaaggaataggtaaaaagaagttagagaccataattgagtcttatagagaacaaaga
gaattaaaaaatataactatatttttacaaacccatggattaagtgtaaatcagtgcttg
aagatttataaaaaatatggagctagttcagttgatacagttaaaaataatccatatata
ctttgtgatgaaatttcaggaataggatttaagacatctgacaaaattgctaggagttta
gggatagaaattgattcaccttttagaattcaaagtggtataagatatgtaataaatgaa
ttttgtactaatgggcacacatttatgccaaaggatgaacttataaaggaagcaagtaat
gtattaactgtaagtgaagatataatagaagaaaatattaaaaatgcagctttagataga
aaaataaagttagagaaagttaatgataaagaaggtgttttcacaatacctaattattat
tgtgagcttggaataactaataggattttaactttagctataagcaatttccaagatata
agtgtagatgtagatcacctaatacttcaatttgaaaagaaaaataatataacttttgca
gaatcccagaaagatgctataataagtgcttttcaaaatggaatagagataataactggg
ggaccaggaacaggaaagaccactataataaagtgtataattgaaatttttgaaacctgt
ggtttgaaggttcttttgggagcacctactggaagagcggctaaaagaatgagtgagtct
acaggaaaagaagctaccacaatacatagaatgcttgacatgggagtctttgaaaaagaa
gaaagtgtttttgtaaccaatgcagaggaacattccttagaggctgatgtggttataata
gatgaggcatcaatgattgatataactttaatgaatgctttacttaaatctattaaggta
ggtactaggcttataatagtaggagatgttgatcagcttccatcagtaggagctggaaat
gtattaaatgattttatagagagtggatttacaaaggttgtacgtctaaaggaaatattt
agacaaggaaaagagagtatgattgtagtaaatgcacataaaataaataaaggtgagatg
cctaagttaaatgaaaaaggtactgatttcttcttcataagaaatgatattcaagaagga
atattaaatactattatagatttaataaatactaggttgcctaggtttaattcaaattgg
gataagttaaaaagtatacaggttttagttcctatgaaaaagggtgtattaggagttaca
aatttaaatgaaagaattcaaaatgtcttaaacccaaaggctccgtataaaaaagaaaaa
gaatttagaagtatggtatttagagagggagataaggttatgcagataaagaataactac
tctctaaaatggaccagaatagctggaaagggtgaccatgaaggtttgggtgtatttaat
ggagatatgggatttatagaaagtatagatttagaagggaaaaaactatctataatcttt
gatgatgaaagaagagttatttatgattttatttatttagatgagttagatttggcttat
gcaatcacaatacataaaagtcaaggaagtgaattccctgtagtaataatacctgcatat
atgggagcaccattacttatgaatagaaatttattatatacaggaataactagggcaaaa
gaaatggttgtagtagttggaatacctaaagcattaaaatacatggttgataatacaagg
agtatggaacgctattcctctttaaattggagaataaaagaagtaatatctaatgaggtt
tttgaacaagattaa

DBGET integrated database retrieval system