KEGG   Clostridium perfringens SM101: CPR_2159Help
Entry
CPR_2159          CDS       T00379                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cpr  Clostridium perfringens SM101
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CPR_2159 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CPR_2159 (murA)
Enzymes [BR:cpr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     CPR_2159 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(2386312..2387577)
Genome map
AA seq 421 aa AA seqDB search
MGKIVVQGGKKLKGEVNINTAKNSVLPIIAGSILATDGVLINELPMLQDVFTICNVIEQL
GYDLKIDKKENKLIVPPLNKNPLIPSEYLVKKMRASFLIMGPMIAKYGEFKLARPGGCNI
GSRPIELHLKGLRALGAENTNCGNGFVCIKAKKLTGSKIYLDFPSVGATENIMMAATMAK
GTTVIENAAQEPEITDLINFLNSMGAKIYIEKPGEIIIEGVDSLTSTEYTPIYDRIEAGT
FMVAAAITGSEIKINGVNKDHCSAIISKLKEAGTEFFDVHNNENSIIVKGNEEIKPINIK
TMPYPGYPTDMQSQMMSLLSIAKGSSIITESVFENRFMNVDELRRMGANIQIEGRTALIE
GVDNLTGCEVKATDLRAGAALILAGLVAKGETIVTDIYHIDRGYVEIENKFRALGADISR
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaatagtagtacaaggtggaaagaaattaaaaggagaagtaaatataaataca
gctaagaattcagttttaccaataattgcaggaagtatattagctactgatggtgtacta
ataaatgaattaccaatgttacaagatgtttttacaatttgtaatgttatagagcaatta
ggatatgatcttaaaatagataagaaagaaaacaaattaattgtaccaccactaaataaa
aatcctctaattccaagtgagtatttagtaaaaaaaatgagagcttcatttttaataatg
gggccaatgatagctaaatatggggagtttaaattagctaggccaggtggatgtaatata
ggttctaggcctatagaattacacctgaaaggacttagagcgctaggtgctgaaaatacc
aattgtggaaatggatttgtatgtataaaggcaaaaaaattaacaggaagtaaaatatat
ttagactttccatcagttggagcaacagagaatataatgatggcagcaactatggctaaa
gggactacggtaattgaaaatgcagctcaggagccagaaataactgatttaattaatttt
ttaaattctatgggagctaaaatttatattgaaaaaccgggtgaaataataatagaaggt
gttgattcattaacttcaactgagtacactcctatatatgatagaatagaagctggaaca
tttatggttgcagcagcaataacaggatcagaaataaaaataaatggagtaaataaagat
cattgttcagctataatatctaagttaaaagaagctggaacagagttttttgacgtccat
aataatgaaaatagtataatagtaaagggtaatgaagaaataaagccaattaatataaaa
acaatgccttatccaggatatcctactgatatgcaatcacaaatgatgagtttattgagc
atagcaaaaggaagcagtatcataactgaaagtgtttttgagaatagatttatgaatgta
gatgaattaagacgtatgggtgcaaacatacaaatagaaggaagaacggctttaattgaa
ggagtagataacctaactggatgtgaagttaaggcaactgatttaagggcaggagctgct
ttgattttggctggacttgtagcaaaaggagagacaatagttactgatatatatcatata
gatagaggttatgttgaaatagaaaataagttcagagccttaggcgctgacataagtaga
atataa

DBGET integrated database retrieval system