KEGG   Clostridium perfringens SM101: CPR_2170Help
Entry
CPR_2170          CDS       T00379                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr00071  Fatty acid degradation
cpr00280  Valine, leucine and isoleucine degradation
cpr00310  Lysine degradation
cpr00362  Benzoate degradation
cpr00380  Tryptophan metabolism
cpr00620  Pyruvate metabolism
cpr00630  Glyoxylate and dicarboxylate metabolism
cpr00640  Propanoate metabolism
cpr00650  Butanoate metabolism
cpr00900  Terpenoid backbone biosynthesis
cpr01100  Metabolic pathways
cpr01110  Biosynthesis of secondary metabolites
cpr01120  Microbial metabolism in diverse environments
cpr01130  Biosynthesis of antibiotics
cpr01200  Carbon metabolism
cpr01212  Fatty acid metabolism
cpr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPR_2170
   00630 Glyoxylate and dicarboxylate metabolism
    CPR_2170
   00640 Propanoate metabolism
    CPR_2170
   00650 Butanoate metabolism
    CPR_2170
  Lipid metabolism
   00071 Fatty acid degradation
    CPR_2170
   00072 Synthesis and degradation of ketone bodies
    CPR_2170
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CPR_2170
   00310 Lysine degradation
    CPR_2170
   00380 Tryptophan metabolism
    CPR_2170
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CPR_2170
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CPR_2170
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CPR_2170
Enzymes [BR:cpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CPR_2170
Exosome [BR:cpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPR_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABG86544
UniProt: Q0SQY7
Position
complement(2395858..2397036)
Genome map
AA seq 392 aa AA seqDB search
MREVVIASAVRTALGSFGGSLKDVPAVDLGALVIKEALNKAGVKPECVDEVLMGNVIQAG
LGQNPARQAAVKAGLPVEIPSMTINKVCGSGLRCVALAAQMIKAGDADVIVAGGMENMSQ
GPYVLKTARFGQRMGDGKMVDAMVNDALTDAFNGYHMGITAENIAEQWGLTREMQDEFAA
NSQIKAEAAIKNGKFKDEIVPVVIPKRKGDPIVFDTDEFPRFGTTAEKLAKLRPAFKKDG
TVTAGNASGINDGAAALVVMSAEKAKELGVTPICKIVSYGSKGLDPSIMGYGPFYATKKA
LEGTGLTVADLDLIEANEAFAAQSLAVAKDLEFDMSKVNVNGGAIALGHPVGASGARILV
TLIHEMMKRDAKRGLATLCIGGGMGTALIVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggtagttattgcaagtgcagtaagaacagcattaggttcatttggtggttca
ttaaaggatgttcctgctgtagatttaggagctttagttattaaagaagctttaaataaa
gctggtgtaaaaccagaatgtgttgatgaagttttaatgggaaatgtaattcaagctgga
ttaggacaaaaccctgcaagacaagcagctgtaaaagctggtttaccagttgaaattcct
tcaatgacaataaataaagtttgtggttcaggtttaagatgtgtggctttagcagctcaa
atgataaaagcaggagatgctgacgtaatagtagctggtggtatggaaaacatgtcacaa
gggccatatgttttaaaaactgcaagatttggtcaaagaatgggcgatggaaaaatggtt
gatgctatggtcaatgacgctttaacagatgcatttaatggataccatatgggtataact
gctgaaaatatagcagaacaatggggattaactagagaaatgcaagatgaatttgctgca
aattctcaaattaaagccgaagcagctataaagaatggaaaattcaaagatgaaatagtt
ccagtagtaattccaaaaagaaaaggtgatccaatagtatttgatactgatgaattccct
agatttggaacaactgctgaaaaattagctaagttaagaccagcattcaaaaaagatggt
acagttacagctggtaatgcatcaggtataaatgatggtgctgctgcgttagttgttatg
agtgctgaaaaagcaaaagaattaggagtaactccaatttgtaaaatagtttcttatggt
tcaaaaggattagatccttcaattatgggatatggcccattctatgctactaaaaaagct
ttagaaggaactggattaacagttgcagatcttgacttaatagaagcaaatgaagctttt
gcagctcaaagtttagcagttgctaaagatttagaatttgatatgagtaaagttaatgta
aatggtggagctatagctttaggacatccagtaggagcttcaggggctagaatattagtt
acattaattcacgaaatgatgaagagagatgctaagagaggtttagcaacactttgtata
ggtggaggaatgggaactgctttaatagtagaaagataa

DBGET integrated database retrieval system