KEGG   Clostridium perfringens SM101: CPR_2540Help
Entry
CPR_2540          CDS       T00379                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cpr  Clostridium perfringens SM101
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CPR_2540
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPR_2540
   00620 Pyruvate metabolism
    CPR_2540
   00650 Butanoate metabolism
    CPR_2540
  Lipid metabolism
   00071 Fatty acid degradation
    CPR_2540
  Amino acid metabolism
   00350 Tyrosine metabolism
    CPR_2540
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CPR_2540
   00626 Naphthalene degradation
    CPR_2540
Enzymes [BR:cpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CPR_2540
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CPR_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(2763099..2765696)
Genome map
AA seq 865 aa AA seqDB search
MKVTNVDELMLRLEKVRAAQKEFSKFSQEQVDEIFRQAAVAANNERIRLAKMAVEESGMG
IVEDKVIKNHFAAEYIYNKYKNEKTCGVIEKDESFGITKIAEPIGVVAAIVPTTNPTSTA
IFKALISLKTRNAVFFSPHPRAKNSTIEAARVVLEAAVKAGAPKDIIGWIDEPSVEMSQV
LMAEADIILATGGPGMVKAAYSSGKPAIGVGAGNTPAIIDETAHLKMAVNSILLSKTFDN
GVICASEQTVLVVDKVYDEVRKEFADRGAYFLKDKEIDKVRKTILINGNLNANIVGQSAW
KIADMAGVKVPKDTKVLIGEVESVELEEPFSHEKLSPVLGMYRVANFEEALVKAERLVEL
GGFGHTSVLYTDTMKSQDRVKKFGATMKTGRTIINMPSTQGAIGDIYNFKLAPSLTLGCG
SWGGNSVSENVGPKHLINVKSVAERRENMLWFRVPEKVYFKYGALGVALRELKDLNKKKV
FIVTDNVLASLGYVDKITNVLEEIGVDFRVFSEVTPDPTLECAKKGAEAMRSYQPDTIIA
LGGGSPMDAAKIMWVMYEHPEVAFEDLAMRFMDIRKRVYPFPTMGQKAMMISVPTSAGTG
SEVTPFAVITDEESGVKYPLADYELTPDMAIIDAELMMNMPKGLTAASGIDALTHALEAY
VSVLASEYTNGLALEAIRLIFKYLPQAYAEGTTNIKAREKMAHASTMAGMAFANAFLGVC
HSMAHKLGSEHHIAHGVANGILIDHVIRFNAVDNPRKQAAFPQYKYPNAKWRYTVIADYL
GLGGKNEEEKVNNLIKAIDNLKKTVGIPATIADCGVSKEAFYATLEKMSEDAFDDQCTGA
NPRYPLISEIKQMYINAFEGKKDRV
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaacaaatgtagatgaattaatgcttagattagaaaaagttagagcagctcaa
aaagagttctcaaaattttctcaagagcaagtagatgaaatatttagacaagcagcagta
gcagctaataacgaaagaatcagattggcaaaaatggctgttgaagaatcaggaatgggt
atagttgaagataaagttataaaaaaccattttgctgcagaatacatatacaataaatat
aaaaatgaaaaaacttgtggagttatagaaaaagacgaatcatttggtatcactaaaata
gcagagccaataggtgtagtagcagcaatcgttcctactacaaacccaacatcaacagct
atattcaaagctttaatatcattaaagactagaaacgctgtattcttttcaccacatcca
agagctaaaaactcaacaatagaggcagctagagttgttttagaagcagctgttaaagca
ggagctccaaaagatataatcggatggatagatgagccatcagttgaaatgtcacaagta
ttaatggcagaagcggatatcatactagctactggtggtccaggaatggttaaagcagct
tactcatcaggaaaaccggctatcggggttggagcaggtaatacaccagcaatcatagat
gaaacagctcacttaaaaatggcagtaaactcaatattattatcaaaaactttcgataac
ggtgtcatctgtgcatcagagcaaacagtattagttgttgataaagtttatgatgaagta
agaaaagagtttgctgatagaggagcttacttcttaaaagataaagaaatagataaagta
agaaaaacaattttaataaatggtaacttaaatgctaatatagttggtcaatcagcatgg
aaaatagctgacatggcaggtgttaaggttccaaaagatactaaagttttaattggtgaa
gttgagtcagttgaattagaagaaccattctcacatgaaaaattatcaccagtattagga
atgtacagagtagctaactttgaagaagctttagttaaagctgaaagattagttgaactt
ggtggattcggacatacttcagttttatacactgatacaatgaaatcacaagatagagtt
aaaaaattcggtgcaactatgaaaactggtagaacaataataaatatgccatcaactcaa
ggagctatcggagacatatacaacttcaagctagcaccatcattaacattaggttgtgga
tcatggggtggaaactcagtttcagaaaacgttggtcctaaacacttaataaatgttaag
agtgtagctgagaggagagaaaatatgctttggttcagagttccagaaaaagtttacttc
aaatatggtgctttaggagttgctcttagagaattaaaagatttaaacaagaaaaaagta
tttatagtaacagacaacgtattagctagtctaggatatgttgataaaataacaaatgtt
ttagaagaaataggtgtagattttagagtattttcagaagttactccagacccaacttta
gaatgtgctaaaaaaggtgctgaagcaatgagaagttatcaaccagatacaatcatagct
cttggtggaggttcaccaatggacgcagctaagattatgtgggtaatgtatgagcatcca
gaagttgctttcgaagatttagcaatgagattcatggatataagaaagagagtttaccca
ttcccaactatgggtcaaaaagctatgatgatttcagttccaacatcagctggtactggt
tcagaggtaacaccattcgcagttataactgatgaagaatcaggagtaaaatatccatta
gcagattatgaattaactccagatatggctatcatagatgctgagcttatgatgaatatg
ccaaaaggattaacagctgcatcaggtatagacgcattaactcatgctttagaagcttac
gtttcagttttagcatcagaatacactaatggattagctttagaagctataagattaata
ttcaaatatttaccacaagcttatgctgaaggtactacaaacataaaagcaagagaaaaa
atggctcatgcttcaacaatggctggtatggcattcgctaacgcattcttaggagtatgt
cactcaatggcacacaaattaggatcagaacaccatatagcacacggagttgctaacgga
atcttaatagaccatgtaataagattcaacgctgttgacaacccaagaaaacaagctgca
ttcccacaatacaaatatccaaatgctaaatggagatatacagtaatagctgactactta
ggattaggtggaaagaacgaagaagaaaaagttaataacttaatcaaggctatagataac
cttaagaaaacagttggaatccctgcaacaatagctgattgtggagtttcaaaagaagca
ttctacgctacattagaaaaaatgagtgaagatgcattcgatgaccaatgtactggtgct
aacccaagatacccattaataagtgaaatcaagcaaatgtacatcaatgctttcgaaggt
aaaaaagacagagtttaa

DBGET integrated database retrieval system