KEGG   Clostridium perfringens SM101: CPR_2559Help
Entry
CPR_2559          CDS       T00379                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cpr  Clostridium perfringens SM101
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CPR_2559 (glpK)
Enzymes [BR:cpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CPR_2559 (glpK)
Exosome [BR:cpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPR_2559 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
complement(2785109..2786611)
Genome map
AA seq 500 aa AA seqDB search
MKKYIVALDQGTTSSRAIIFDKEQNIIGVSQKEFNQIYPREGWVEHDPMEIWATQYSVLQ
EVMAKCNITQENIAAIGITNQRETTIVWDKNTGVPIYNAIVWQCRRTADICDDLKERDGL
VDYIRENTGLVLDAYFSGTKIKWILDNVEGAREKAEKGELLFGTVDSWLVWKLTNGKVHV
TDYTNASRTMIFNIKNLEWDERMLKELDIPRSMLPEVKNSSEIYGYANLGAKGGIRVPIA
GIAGDQQAALFGQAAFNKGDVKNTYGTGCFLLMNTGEELVKSKSGLLTTIAIGLHGKVQY
ALEGSVFVGGAVIQWLRDELRIISDSSDTEYFATKVEDNGGVYVVPAFVGLGAPYWDMYA
RGTIVGLTRGTNRNHIIRASLESIAYQTRDVLEAMINDVGYDINCIKVDGGASRNNFLMQ
FQSDLVGKKVIKPIITETTALGAAYLAGLAVGYWSDKEEIAKLWFASEEFEPNISEERRN
KYYKKWKKAIERSKEWAIED
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatatagtagcattagatcaaggaacaacaagttctagagcaataattttt
gataaagaacaaaacattattggagtaagccaaaaggaatttaatcaaatttatcctaga
gaaggatgggttgagcatgatccaatggaaatatgggcaactcaatatagtgtacttcaa
gaagttatggctaagtgtaatataactcaagaaaatatagcagctattggaataactaat
caaagagaaactacaatagtttgggacaaaaatacaggggttccaatatacaacgcaatt
gtttggcaatgtagaagaactgctgatatatgcgatgatttaaaagaaagagatgggctt
gtagactatattagagaaaatacaggacttgtacttgacgcatatttttcaggaacaaaa
ataaaatggatattagacaatgttgaaggtgcaagagaaaaagctgaaaagggtgagctt
ttatttggtacagtagacagttggcttgtttggaagcttacaaatggaaaagttcatgta
actgattatactaatgcatctagaactatgatatttaacataaagaaccttgaatgggat
gaaagaatgttaaaggaactagacattcctagaagtatgttaccagaagtaaaaaattca
tctgaaatttatggatatgcaaaccttggagcaaaaggtggaataagagttcctatagct
ggaatagctggggaccaacaagctgctttatttggacaagctgcatttaataaaggtgat
gtaaaaaatacttatggaacaggatgttttttattaatgaacacaggagaagaacttgtt
aaaagtaaatcaggacttttaacaacaatagctatcggattacacggaaaagttcaatat
gctttagaaggatcagtatttgttggaggagctgttattcaatggcttagagatgaatta
agaattataagtgattctagtgatactgaatactttgctacaaaagtagaagataatgga
ggagtatatgttgttcctgccttcgttggattaggagctccttattgggatatgtatgct
cgtggaacaatagtaggattaacacgtggaactaatagaaatcatataataagagcatca
cttgaatcaattgcatatcaaacaagagatgtgcttgaagctatgataaacgatgttgga
tatgatataaattgtataaaggtagatggaggagcaagtagaaataatttcttaatgcaa
tttcaatcagacttagttggtaaaaaggtaattaagcctataattacagaaacaacagct
ttaggggcagcttaccttgctgggctagcagttggatactggagtgataaagaagaaata
gctaagttatggtttgctagtgaagagtttgaaccaaatatttcagaagagagaagaaat
aaatattataagaaatggaaaaaagctattgaaagatcaaaagaatgggcaattgaagat
taa

DBGET integrated database retrieval system