KEGG   Clostridium perfringens SM101: CPR_2583Help
Entry
CPR_2583          CDS       T00379                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr00330  Arginine and proline metabolism
cpr00332  Carbapenem biosynthesis
cpr01100  Metabolic pathways
cpr01130  Biosynthesis of antibiotics
cpr01230  Biosynthesis of amino acids
Module
cpr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CPR_2583 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CPR_2583 (proB)
Enzymes [BR:cpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CPR_2583 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PCI
Motif
Other DBs
NCBI-ProteinID: ABG87225
UniProt: Q0SPX7
Position
complement(2813077..2813886)
Genome map
AA seq 269 aa AA seqDB search
MRKALKDSKRIVVKVGTSTLTYENGSVNLMRIEKLSRVISDICNMGKEVVLVSSGAIGVG
VGKLRLEKKPETIREKQAVAAVGQCALMHIYNKFFGEYSHVVAQVLLTRDVLENERMKNN
VCNTFDTLLEKGIIPIVNENDAISIDEIQNILNFGDNDNLSAIVSTLVNADTLIILSDID
GFYDSDPRTNEDSKMLKEVYEITPEIEECAGGAGSNRGTGGMVTKLSAAKVATSNGIDMI
LANGENPEILINILNGEDIGTMFVAKKGE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcattaaaagatagtaaaagaatagttgttaaggttggaacttctacatta
acttatgaaaatggaagtgtaaacttaatgagaatagaaaaattatctagagtaatttca
gatatatgtaatatgggaaaagaagttgttcttgtttcatcaggagcaattggagttgga
gttggaaaacttagacttgagaaaaaaccagagactataagagaaaagcaagctgtagct
gctgttggacagtgtgctttaatgcatatatataataaatttttcggagaatatagccat
gttgtggcacaagttcttttaactagagatgtactagaaaatgaaagaatgaaaaataac
gtatgtaatacatttgatactttgttagaaaaaggaattatacctatagttaatgagaat
gatgctatatcaatagatgagatacaaaacatattaaactttggagataatgataatctt
tcagctatagtttctactttagtaaatgcagatactttaataatattatctgatatagat
ggtttctacgattcagatccaagaactaatgaggatagtaagatgcttaaagaagtttat
gaaataactcctgaaatagaagaatgtgcagggggagctggaagtaatagaggaacaggc
ggaatggtaactaaactttcagcagctaaggtagcaacaagtaatggaatagatatgatt
ttagctaatggagaaaatccagaaatattaattaacatattaaatggtgaagatatagga
actatgtttgtagctaagaagggggaataa

DBGET integrated database retrieval system