KEGG   Clostridium perfringens SM101: CPR_2603Help
Entry
CPR_2603          CDS       T00379                                 

Definition
(GenBank) 6-phospho-beta-glucosidase bgla
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr00010  Glycolysis / Gluconeogenesis
cpr00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPR_2603
   00500 Starch and sucrose metabolism
    CPR_2603
Enzymes [BR:cpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CPR_2603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: ABG86616
UniProt: Q0SPV7
Position
complement(2837508..2838944)
Genome map
AA seq 478 aa AA seqDB search
MIYEKLDNFRSDFLWGSASAAYQVEGGWDQDGKGKSIWDIYTKKEGTTYKNTNGDIAVDH
YNRYKEDVSLMAEMGLKAYRFSIAWTRIYPNGRGKVNEEGLKFYENLIDELIKNDITPIV
TLYHWDLPQHLQDLYGGWESREIINDFNNYCVTLFKRFGNKVKYWVTLNEQNVFLTLGYL
TALHPPGVKDQKRMLQANHIANLANAKVIESFRKYVSNGMIGPSFAFNPNYAYSCNPQDV
LAAENAEDLNCNWWLDVYCKGVYPTFALRYYERLGIAPIIEDGDLELLARVKPDFIGINY
YQTTTVAMNSLDGVGASEGMNNTGKKGTTKESGIPGVYKNVKNPYLETTNWDWNIDATGL
RTGLRRLTSRYGLPILITENGLGEFDKLEDNIVNDDYRIKYLKEHIIACKEAITDGVELL
GYCTWSFTDLLSWLNGYQKRYGFVYIDRDENDEKDLRRIKKKSFYWYKDVISSNGENL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgaaaaattagataactttagaagtgatttcctatggggatcagcatcagca
gcatatcaagttgaaggtggatgggatcaagatggaaaaggaaaaagtatttgggatata
tatactaaaaaggaagggacaacctataaaaatactaatggggatatagcagtagatcat
tataacagatataaagaagatgtatctttaatggcagaaatgggattaaaagcttataga
ttttcaattgcatggactcgtatatatcctaatggtagaggaaaggtaaatgaagaagga
cttaagttttatgaaaatttaattgatgagctaataaaaaatgatataactccaatagtt
acattatatcactgggatttaccacagcatctacaggatttatatggtggatgggaatca
agggaaataataaacgatttcaacaattattgtgtaactttatttaagagatttggtaat
aaggttaaatattgggttacgttaaatgaacaaaatgtatttttaacattaggatattta
acagcattacatccaccaggagttaaggatcaaaagagaatgttacaggcaaatcatatt
gcaaatttagcaaatgcaaaggttattgaatcttttagaaagtatgtttcaaatggaatg
attggtccaagctttgcattcaatcctaattatgcttatagttgtaatccacaagatgtg
ttagctgcagaaaatgcagaagatttaaattgtaattggtggcttgatgtttattgtaag
ggtgtatatccaacgtttgcattaagatattatgaaagattaggaatagcaccaataatt
gaggatggggatcttgaattattagcaagagtaaaaccagactttattggaattaattat
tatcaaacaacaacagttgcaatgaattcattagatggggttggagcttctgaaggaatg
aataatactggtaaaaagggaactacaaaggaaagtggaataccaggtgtatataaaaat
gtaaaaaatccttacttggaaacaactaattgggattggaatatagatgcaacagggctg
agaactggtttaagaagattaacaagtagatatggattgcctatattaattacagaaaat
ggccttggtgaatttgataagctagaagataatatagtaaatgatgattatagaattaaa
tatttaaaagaacatattattgcatgtaaagaagcaattactgatggtgttgagctttta
ggatattgtacttggtcatttacagatttgttaagctggcttaatggatatcaaaaacgt
tatggatttgtatatattgatagagatgaaaatgatgaaaaagatttaagaagaattaag
aagaaaagtttctattggtataaggatgtaataagtagtaatggtgaaaatttataa

DBGET integrated database retrieval system