KEGG   Colwellia psychrerythraea: CPS_0169Help
Entry
CPS_0169          CDS       T00258                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cps  Colwellia psychrerythraea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPS_0169 (hemB)
Enzymes [BR:cps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CPS_0169 (hemB)
Exosome [BR:cps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPS_0169 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
178463..179509
Genome map
AA seq 348 aa AA seqDB search
MSHNGNSAFGQYPARRMRRMRVDDHTRRLMAESQLTVNDLIYPVFVLEGDNQREAIASMP
GVERKSIDLLLEEAQELVDLGIPAIALFPVTPSDKKSLMAEEAYNPDGLAQRAVRALKAK
FPQLAVITDVALDPFTTHGQDGILSESDDNKAGKTGYVVNEVTKDILVKQALSHAEAGAD
IVAPSDMMDGRVGAIREGLEENGFVNTKILAYSAKYASNYYGPFRDAVGSSGNIKGGNKH
TYQMDPANSNEAMHEVAQDIAEGADMVMVKPGMPYLDIVRRVKDTFQVPTYAYQVSGEYA
MHMAAIQNGWLAEKPCVMEGLLAFKRAGADGILTYFAKQVARWLKEDA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacaatggtaattcagcatttggtcaatatcctgctcgtcgcatgcgccggatg
cgcgttgacgatcatactcgtcgtttaatggctgaatctcagttaacggtcaatgattta
atatacccagtttttgtgcttgaaggcgataatcagcgagaagcgatagcttcaatgcct
ggtgtcgaacgtaaaagtattgatctgcttttggaagaagcacaggaattggttgattta
ggtattccggctattgcacttttccctgtgacaccaagtgataaaaagtcgcttatggcg
gaagaagcttataaccctgatggattagcgcaacgtgcagtacgtgcacttaaagctaaa
ttcccacagcttgctgtgatcactgatgttgctcttgacccgtttaccacacatggtcaa
gacggtattttaagtgagagtgatgataacaaagcagggaaaacaggctatgttgttaac
gaagtcactaaagatattttggtaaagcaggctttatcacatgctgaagcaggagccgat
attgtggcaccttcagatatgatggatggacgtgtcggtgctatcagagaaggattagaa
gaaaatggctttgttaatactaaaatattagcctactctgcgaagtacgcttctaattac
tatgggccatttcgtgatgctgtcgggtcttctggtaatattaaaggtggtaataagcat
acttatcaaatggatcctgcaaatagtaatgaagctatgcatgaagttgcccaagatatc
gctgaaggtgccgacatggtcatggttaagccaggcatgccttatttagatatagtgcgt
cgtgttaaggatacttttcaagtaccgacctacgcttatcaagtcagcggtgaatatgcc
atgcatatggcggcaatacaaaatggttggttagctgagaaaccatgtgtaatggaagga
ttattagcatttaaacgtgctggagccgatggaattttgacttattttgctaagcaagtt
gcgcgttggttgaaagaagacgcttaa

DBGET integrated database retrieval system