KEGG   Colwellia psychrerythraea: CPS_0384Help
Entry
CPS_0384          CDS       T00258                                 

Gene name
speB
Definition
(RefSeq) agmatinase
  KO
K12255  guanidinobutyrase [EC:3.5.3.7]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00330  Arginine and proline metabolism
cps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CPS_0384 (speB)
Enzymes [BR:cps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     CPS_0384 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AAZ24263
UniProt: Q489X2
Position
385149..386105
Genome map
AA seq 318 aa AA seqDB search
MTDNNFNQPLGGNQMPRFGGPGTMFRLPSSEISNELDIGIVGVPLDIGASNRSGTRFGPR
SVRNESVLVRPYGMYTKAAPFDSFQIADIGDTPINTFNLADSIRIIEAHYDTIMASNIKP
VTVGGDHTISLPILRALHKKHGMMALVHVDAHADINDSMFGEKECHGTIFRRAIEEGLVD
PKKMIQIGQRATGYSAGDFQWAVDRGVRVVQAEECWLKSLVPLMEEVREVIGEDIPTYLT
FDIDGIDPAFAPGTGTPEPAGLTSPQALEIIRGMWGTNLIGADLVEVSPPYDTSGNTSLL
AANLIFEMLCSFPGCIRR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacagataataatttcaatcagccattaggcggtaatcaaatgccacgtttcggtggt
ccaggtactatgtttcgcttaccaagcagtgaaataagcaatgaattagatataggtatt
gtaggtgtgccactggatattggtgctagtaaccgaagtggtacacgctttggccctcgt
tctgttcgcaatgaatcagtcttagttcgtccttacggtatgtataccaaagctgcgcca
tttgatagtttccaaattgcagacattggtgatactccaataaatacattcaatcttgct
gactctattcgaattattgaagcgcattacgataccattatggcgagtaatattaagcca
gtgactgttggtggcgatcacactatcagtttgcctatcttgagagccttgcataaaaag
cacggcatgatggcattagttcatgttgatgcccatgcggatattaatgattctatgttt
ggtgaaaaagagtgccacggtactattttcagacgtgctattgaagaaggtttagttgac
ccgaaaaaaatgattcaaattggtcaacgtgcaaccggttatagtgcgggtgattttcaa
tgggcggtggaccgaggcgtaagagttgtacaggcagaagaatgttggttgaaatcgtta
gtgcccttaatggaagaggtgcgtgaggttattggtgaagatataccgacttatttaacg
tttgatattgatggtattgatccagcatttgcgccaggaactggcacaccagagccagca
gggttaacctcgccacaagccttagagatcattcgtggcatgtggggtactaatcttatt
ggtgctgacttagttgaggtatcaccaccatatgatacttcaggtaatacctccttatta
gcagccaacctcatttttgaaatgctttgtagctttccaggttgtattcgtagataa

DBGET integrated database retrieval system