KEGG   Colwellia psychrerythraea: CPS_0506Help
Entry
CPS_0506          CDS       T00258                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
cps  Colwellia psychrerythraea
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CPS_0506
Enzymes [BR:cps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     CPS_0506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(507211..508845)
Genome map
AA seq 544 aa AA seqDB search
MRLSSEVVVVKPFTNQWSEEDIILITYGDSIIKADQPPLQTLKHFLDTTIENTINSVHIL
PFFPYSSDDGFAVIDYSSVNESLGTWQDIEDISKDYHLMSDLVINHCSSRSAWFDNFVKG
EGQGSDYFFTALPDDNLTDVVRPRTSPLLKEVETGNGKKFVWCTFSHDQVDFDFRNPEVL
AAFTSIIRQYLDIGVKIFRLDAIAFLWKVTGTTCINLPETHEVVRLLRTLIESAEPQAII
ITETNIPNTQNLTYFGNANEAHGIYNFSLPPLLLNTLLTGNCLYLKRWLMSMPPSQDGTL
YFNFIASHDGIGLRPAEGLLSENELDTLVHTVENFGGKISWRTSDTGEQKAYEMNISLYD
AMQGTVDGKDQWNFERFICAHAIMFALEGIPGIYIHSLLGTQNDYQKLANTHHNRSINRR
RWQENALEEALANKSLHHARVLSTLKSLLNTRIKQPAFHPNATQFTLHLGLQLFGFWRQS
QDRKQSIFCVSNVSDQPITLPLSELNLIITESWFELISKKEITELTQKILLTPYQTVWIS
NVIT
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgcgattatcaagcgaggtggtggttgtaaaaccttttaccaaccaatggtccgaggaa
gatattattttgatcacctacggtgatagcattatcaaagcagatcaaccgccattacaa
acattaaagcattttttagacactaccattgaaaataccattaatagtgttcacatttta
ccctttttcccctacagctcagatgatggttttgccgttattgattattcttcagtcaat
gaatctttaggaacatggcaagatatagaagatatcagtaaagactatcacttgatgtca
gatcttgtgattaaccactgctccagccgaagtgcttggtttgataactttgttaaagga
gaaggtcaaggtagcgattattttttcactgcactacccgatgataatttaacagatgta
gtgcgcccacgtacctcaccattactcaaagaagttgaaacgggtaatggcaaaaaattt
gtctggtgcacctttagccacgaccaagtcgactttgattttcgtaaccctgaagtatta
gcggcatttacgtcaatcatcaggcagtacctagacatcggcgttaagatattccgctta
gatgctatcgcctttttatggaaagtaacaggtactacctgcatcaatttacctgaaaca
catgaggttgttcggttattgagaactctcattgaatcggctgaacctcaagcgattatc
atcaccgaaacaaatatccctaatacccaaaacctgacgtactttggtaatgctaacgaa
gcgcacggcatttataacttttcattaccgccccttctattaaacaccctactcacaggt
aattgcttatatttaaaacgttggttaatgagtatgcctccgtcacaagacggcacccta
tattttaattttattgcctcacatgacggtattggtttacgtccggctgaaggtttatta
agtgaaaatgaacttgataccttagtgcacacggtagaaaattttggtggtaaaatttca
tggcgtacttctgatactggcgagcaaaaagcgtacgagatgaatatctcactctatgat
gcgatgcaagggacggttgatggaaaagatcaatggaattttgaacgttttatttgtgca
catgccattatgtttgctcttgaaggcataccaggtatttatattcatagtctgttgggt
acgcaaaacgactatcaaaaattagcaaatacccaccataaccggtctattaatcgacgt
cgttggcaagaaaatgctttagaagaggcactcgctaataaaagtttacatcatgcacga
gttctctcgacgttaaaatcattattaaatactcgcattaagcaaccagcctttcatccc
aatgcgacgcagtttacacttcatttaggtttacaactatttggcttttggcgacaaagc
caagatagaaaacaaagtattttttgtgtcagtaatgtttctgatcaacccataacactg
ccattaagtgagcttaatttaattattacggaatcttggtttgagcttattagcaagaaa
gaaatcactgaattaacacaaaaaatactattaacaccttatcaaacagtttggatcagt
aatgtaataacataa

DBGET integrated database retrieval system