KEGG   Colwellia psychrerythraea: CPS_0587Help
Entry
CPS_0587          CDS       T00258                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cps  Colwellia psychrerythraea
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CPS_0587
Enzymes [BR:cps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CPS_0587
Peptidases [BR:cps01002]
 Cysteine Peptidases
  Family C44
   CPS_0587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
589530..590984
Genome map
AA seq 484 aa AA seqDB search
MEFYGPITGEKFAFLLFRDNGEVIEFNHWSQVKEYKSELKISKSSIQIFLRNGCVYPPYT
IYSNVLMLPIGTKLTIDIKNDIFKWENNFCFLDRHSKQDSKPSTSKLKTLIANSFAHLKK
EVKPIYMMQSAGKDSTAMLLGLHEQGIQNVHCVTYEANFRDTESDAAKKIAESLGFEHTI
LFPNYEAEFDALLEYQENAVSITGDFSMLPYIAANKSVFKSDSLVIDGLGNDLYMGYVSN
KLERSIMKCSLGNFSYLEPSKFTSNEVINYAISSIFMKPYERLFPGTRLSSSEIENFTDN
KFIDDDAIYFSKQYNNLDKDDFRAAIRARFCDSTMFQMKAELTTNSFGNEVYFPFSNKEL
VDYYFNLPIEERYDKANSCNKTLLRSMLNEYVEVDDFFKVKSGFRYNMPEFITINKEKIK
KEIIECDLLEQDYSNRFFAKHLDVQKVNYTSACKAYILLVFASWRNRNKLAVVDGHVADK
FDWY
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggagttctacggacctattacaggtgaaaagttcgcttttttgttatttagagataat
ggtgaggtaatagagtttaatcactggagtcaagttaaagagtataaaagtgaactgaaa
atatctaaaagttcaattcagatttttttaagaaatggttgtgtttatcccccatataca
atttattcaaatgtattaatgctaccaattggcactaaattaactattgatattaagaat
gatatttttaaatgggaaaataatttttgttttttggaccgacactctaaacaagatagt
aaaccttcaacctctaaattaaaaacattaattgccaattcatttgctcacttgaaaaaa
gaagttaaacccatctatatgatgcaaagtgctggcaaagattcaactgcgatgctgtta
ggattacatgagcaaggtattcaaaatgttcattgtgtaacttatgaagctaattttaga
gatacagagagtgatgcagctaaaaaaattgcagaatctttaggttttgaacatacgatt
ttgtttccaaattatgaagctgaattcgatgcattattagagtatcaagagaatgctgtg
agtattactggagatttctctatgctaccttatatagctgcaaataaatctgtttttaaa
tcagactctctagttatagatggtttaggtaacgatctctatatgggttatgttagtaat
aaactcgagcgaagtattatgaaatgctcattaggtaattttagctaccttgaaccttca
aaatttacttcaaatgaagttataaactatgcaatatctagtatatttatgaagccatat
gaacgtttatttcctgggactaggttgagttctagtgaaatagagaatttcactgataat
aaatttattgatgatgatgctatatacttctcaaagcagtataacaatttagataaagat
gactttagagccgcaataagagctcgtttttgtgatagtacaatgttccagatgaaagca
gagctaaccactaacagctttgggaatgaagtttacttccctttttcaaacaaagagtta
gtggattattattttaatttaccaatagaagagcgctatgataaagctaacagctgcaat
aaaacattattacgtagcatgcttaatgaatatgttgaagtagatgatttctttaaggtg
aaatcaggctttagatacaatatgcctgaatttattactatcaacaaagaaaaaataaaa
aaagaaattattgaatgcgacctcttagaacaagattattcaaaccgtttttttgctaaa
cacttagatgtacagaaggtgaattatacttcagcttgcaaagcttatattttattggta
tttgcctcttggagaaatagaaataagcttgctgttgtagatgggcatgtagctgataaa
tttgactggtattaa

DBGET integrated database retrieval system