KEGG   Colwellia psychrerythraea: CPS_0649Help
Entry
CPS_0649          CDS       T00258                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00010  Glycolysis / Gluconeogenesis
cps00030  Pentose phosphate pathway
cps00051  Fructose and mannose metabolism
cps00052  Galactose metabolism
cps00680  Methane metabolism
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01120  Microbial metabolism in diverse environments
cps01130  Biosynthesis of antibiotics
cps01200  Carbon metabolism
cps01230  Biosynthesis of amino acids
cps03018  RNA degradation
Module
cps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS_0649 (pfkA)
   00030 Pentose phosphate pathway
    CPS_0649 (pfkA)
   00051 Fructose and mannose metabolism
    CPS_0649 (pfkA)
   00052 Galactose metabolism
    CPS_0649 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CPS_0649 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CPS_0649 (pfkA)
Enzymes [BR:cps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CPS_0649 (pfkA)
Protein phosphatases and associated proteins [BR:cps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CPS_0649 (pfkA)
Messenger RNA biogenesis [BR:cps03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CPS_0649 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AAZ24359
UniProt: Q488W5
Position
647258..648301
Genome map
AA seq 347 aa AA seqDB search
MNNKKTTSIKRIALLTSGGDAPGMNAAIRSVVLAAHHYHIEVIGFYHGYNGLVCEEHIAM
AEPLTLLKVNSIIHLGGTILKSARCQLMHEAKGLQLAADTLNDKNIDALVVIGGDGSFSG
LLALQAYWSGQMIGIPGTIDNDLDGTDYTIGFATAVNTGIEAIDKIRDTADAFERIFIVE
LMGRHCGHITFNVGIACAAEQVLSFENFNANEQSSKLQQLATEITTAKKNRHSSYIIVIA
ENLWPGGAVELARQLHLQADIECTPCILGHIQRGGSPIAKDRILATKMGVAAVQALIDGE
SNIMVAEQNNAMNFITLDEAIKHKKVVSKQLIDAQQNILALTAQTQC
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaaaaaacaacgtcaattaagcgcattgcactattaaccagtggcggtgat
gctccagggatgaatgcagcgatacgttcagttgtattagcagctcatcattatcatatt
gaagtcattggtttttatcatggttataacggcttggtatgtgaagagcatatcgccatg
gctgaaccgttaaccttgttaaaagtaaatagcattattcacctcggtggtacgatattg
aagagtgctcgttgtcagttaatgcatgaagcaaaaggcttacagttagccgcggatacc
ttaaatgataaaaatatcgatgcacttgttgttataggtggtgatggatctttttctgga
ttgctggcgcttcaagcgtattggtcaggtcagatgattggaattccgggaacgatagat
aatgatcttgatgggactgattacactattggctttgccacagcagtaaacactggcata
gaagcaattgacaaaattcgtgataccgcagatgcttttgaacggatatttattgttgag
ttgatggggcgacattgtggccatataacgttcaatgttggtattgcttgtgcggcagag
caggtattatcttttgaaaattttaacgcgaatgagcagtcgtcaaaattacagcaactt
gcgacagaaattaccacagcaaagaaaaatcgtcattcaagttatattattgttatcgca
gaaaacctgtggccaggtggcgctgtagaattagcgagacaattgcacctacaagctgat
attgagtgcacgccctgtatattaggccatatacagcgaggtggctcacccattgctaaa
gatagaatactcgcgacaaaaatgggcgtagctgctgtgcaagcacttatagacggtgaa
tccaatattatggtggcagagcaaaataatgcgatgaattttattacgctggatgaggca
attaagcacaaaaaagtagtaagcaaacagctcattgatgcacaacaaaatatcttggcg
ttaacagcgcaaacccagtgttaa

DBGET integrated database retrieval system