KEGG   Colwellia psychrerythraea: CPS_0799Help
Entry
CPS_0799          CDS       T00258                                 

Definition
(RefSeq) hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 Sacchrp_dh_NADP NmrA Epimerase adh_short Semialdhyde_dh 3Beta_HSD Shikimate_DH NAD_binding_4 GDP_Man_Dehyd ApbA KR
Motif
Other DBs
NCBI-ProteinID: AAZ27766
UniProt: Q488G7
Position
817093..817821
Genome map
AA seq 242 aa AA seqDB search
MTILVVGASGATGRLLVEQLLAQGEKVKIIVRSIDALPDVIKQNDQLMITESTLLDMTDA
ELQQHVQGCRAVVSCLGHNLNFNGMFGHPRRLVTGAVQRLCRAIEATAANITSTPVKFIL
MNTTGNQNTQAGEKVSVAQSMVVGLIRLLLPPHADNEEAAGYLQSRYGRHHKMIEWVAVR
PDSLIDEGSVTHYQAYESPIRSAIFDAGKTSRINVANFMSQLVIDSGTWNKWKSKMPVLY
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgacaattcttgttgttggcgcaagtggcgcaactggtcgtttattggttgagcagtta
cttgctcaaggtgaaaaagtaaaaataatcgtacggtcaattgatgcattacctgatgtg
ataaaacaaaatgatcaattaatgatcacagagtctaccttgttggatatgaccgatgcc
gaattacagcaacatgttcaaggttgtcgtgcagtagtctcatgccttgggcacaattta
aatttcaatggcatgtttggtcatcctcgccgcttggttacgggggcagtccaacgttta
tgtcgcgctattgaagcaacagcagcaaacataacaagtacccctgttaaatttatttta
atgaatactacgggtaatcaaaatacacaggcgggagaaaaagtgtcggttgcacaatct
atggtagttggtttgatccgattattattgccaccacatgccgacaacgaagaggctgcg
ggatatttacaatcacgttatggccgtcatcataagatgattgaatgggtggcggttcgc
cctgacagtttgatagatgaaggtagtgtcacacactatcaagcttatgaatctcctatt
cgtagtgccatttttgatgcaggtaaaaccagtcgaatcaacgttgcaaattttatgtcc
cagttggtcattgatagcggtacatggaataaatggaaaagcaaaatgcctgtcctttat
aataattag

DBGET integrated database retrieval system