KEGG   Colwellia psychrerythraea: CPS_0808Help
Entry
CPS_0808          CDS       T00258                                 

Definition
(RefSeq) conserved hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Chlorophyllase Abhydrolase_1 Chlorophyllase2 DUF900 Lipase_3
Motif
Other DBs
NCBI-ProteinID: AAZ25893
UniProt: Q488F8
Position
complement(826795..827652)
Genome map
AA seq 285 aa AA seqDB search
MIDIKDVELTADNGKPVYATFFCPKEEIKAAVVIAPALGVDKIFYQDFALWLASYGYLVT
TFDYSSMGSADKVHYKESDTTITDWAVFDCKKILEQVSIEIKDKDIYWIGHSLGGQITAM
IPNIGLVSKVITVASGSGYWRKNAAALKYKVWFLWYFVAPVSLKVLGYFPGKRLGMVGNL
PFGVMKQWRAWCLHPHYLLGIENQAVQMAYQLFNKPMTSISFTDDQLMSAENINSLHGFF
SDISPKMIRISAEQLNIENIGHFGFFKKKFKSALWESQLLPELTT
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatagatataaaagatgtagaattaacagccgataatggcaaacctgtttatgctacc
tttttttgcccaaaagaagagataaaagcggcggtagtgatcgctccggctttaggggta
gataaaattttctaccaagatttcgctttatggttagcgagttatggctacctagttact
acctttgattattcttctatggggtctgctgataaagtgcattataaagaatcagataca
accatcactgattgggcggtttttgattgtaaaaaaatattagagcaagtatcaattgag
attaaagataaagatatttattggattggccacagtttaggcggtcaaattaccgcaatg
atccctaatattggcttggtttcaaaagtgatcactgttgctagtggtagtggttattgg
cgtaaaaatgctgcggcattaaaatacaaagtatggtttctctggtactttgttgcgcca
gtgtcactaaaagtattaggttactttcctggtaaacgtttaggtatggtaggtaattta
ccctttggtgtaatgaagcaatggcgagcatggtgtttacaccctcactatttattaggg
atagaaaaccaagcagtacaaatggcttaccagttatttaataaacctatgacctcaatt
tcctttactgacgatcaacttatgtctgctgaaaacattaattctttacatggatttttt
agtgatatttcacctaaaatgatcaggatttctgctgaacaattaaatattgagaatatt
ggccattttggtttttttaagaaaaaatttaaaagcgccttatgggaatcacaattactt
ccagaattaacaacttaa

DBGET integrated database retrieval system