KEGG   Colwellia psychrerythraea: CPS_0809Help
Entry
CPS_0809          CDS       T00258                                 

Definition
(RefSeq) DoxD family protein
  KO
K15977  putative oxidoreductase
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DoxX DoxD QCR10
Motif
Other DBs
NCBI-ProteinID: AAZ26710
UniProt: Q488F7
Position
complement(827693..828157)
Genome map
AA seq 154 aa AA seqDB search
MTTITQRLIQPYTQVSQLLNYLQPLALLGARFYVAWVFFASGLTKLRDWDSTLFLFEEEY
SVPFIPFELAAYLGTAGELILPVLLILGLASRFGALGLTVVNIVAVVSLTEIAPAALYSH
VIWGLLLLQVVLFGAGKLSLDNLLKIKLSKVTDN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaattacccaacgattaattcaaccttacacccaagtgagtcaactgctaaat
tatttacagcccctggcactgctcggtgcaagattttacgtagcttgggtattttttgct
tctggcctaacaaagctaagagattgggattccactttatttttgtttgaagaagaatac
agcgtgccgtttattccttttgaactagctgcgtatttgggcacagcaggtgaactcatt
ctgccagttttattgatactaggtttagccagtcgatttggtgctttaggtttaactgtt
gtaaatatcgttgccgttgtcagcttaactgagattgctcccgcagcactttattcacac
gttatatggggcttactgctattgcaagttgtgttatttggtgcagggaaattatcatta
gataacttattgaaaataaagctaagcaaggttactgacaactaa

DBGET integrated database retrieval system