KEGG   Colwellia psychrerythraea: CPS_0815Help
Entry
CPS_0815          CDS       T00258                                 

Definition
(RefSeq) transcriptional regulator, AraC family
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_6 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AAZ24725
UniProt: Q488F1
Position
831656..832483
Genome map
AA seq 275 aa AA seqDB search
MDQLSQILENLSFNADVFFSGNLCGIQSLGGADSKKGHLHLLKSGVLTIVCEEGHKVTLD
KPSVIFMPGPSKHQVIASESDDAELVCADVDFHSGSGAALVNALPKFICLNIGQHDPVGR
TAHWLFEEAFNKQAGQQMIVNKLGDIFLIQMLRHVIKEGIVIQGMLAGMAHPQLSALMTA
LHKRPQEQWTVELMAETALMSRAKFAALFKDTIGQAPSDYLTDLRIALAQGLLKKDKPVS
FVANEVGYEHGSALARVFRKKTGLSPKEWLMKFRK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggatcaattaagtcaaatattagaaaatctttcttttaatgctgatgtttttttcagc
ggtaacttgtgtggcattcaaagtttaggcggggctgatagtaaaaaaggccatttgcat
ttattaaaatcaggtgtattaaccatcgtttgtgaagaagggcataaagttaccctagat
aaaccgtcggttatttttatgccgggcccgagtaaacatcaagttattgccagtgaatca
gatgatgccgagttagtttgtgctgatgttgattttcattcaggcagtggggcagccttg
gtcaatgcattaccaaaatttatttgtttgaacattggacagcatgatcccgtagggaga
actgcgcattggttgtttgaggaagcgtttaacaaacaagcaggtcagcaaatgatcgtg
aataagcttggtgatattttcttaatacagatgttacgacatgtcatcaaagaaggcatc
gttattcaaggcatgttagcaggtatggcgcaccctcaattatcagcattaatgacagcg
ctgcataagcggccgcaagaacagtggaccgttgagttaatggctgaaacagccttaatg
tcgcgagctaagtttgccgctttatttaaagacaccataggtcaagcgcccagtgactat
ttaacagacttacgtatcgctttagcgcaaggtttattgaaaaaagataaacccgttagt
tttgttgctaacgaagtgggttatgaacatggctctgcattggctagagtgttcaggaaa
aaaacgggattatcaccaaaagaatggttaatgaaatttaggaagtaa

DBGET integrated database retrieval system