KEGG   Colwellia psychrerythraea: CPS_0820Help
Entry
CPS_0820          CDS       T00258                                 

Definition
GGDEF domain-containing protein
Orthology
K13590  
diguanylate cyclase
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
835988..836989
Genome map
AA seq 333 aa AA seqDB search
MSFEDEYQVTSEFSDRTNDFLSSHLISPTPVNYSVIYLHISNENEMLSAAINKKLKQGVL
ITADFMADLFERYVSLTEQIENTVLAPFEKTLSKTLEQITKQVSNEDKAAINLEKLDKIL
AKTKTTTSMDNIVSYLFNTINSTKAQHEELSQKLTTTQQEINQLKDKLASSRQEALVDSL
TGLLNRRGCDEKLQNLSHADTHSSLAIDIDHFKKVNDTFGHFIGDKVIQRIAKTIQSHIG
EQDLAVRFGGEEFVVVMTNTPLAEAKNIAEKIRIGISKMRLKQRDTNTFLPPISVSIGIA
QNDNISEWTTLFEQADTALYQAKNSGRNCCICA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttgaagatgagtatcaagtaacgtctgaattcagcgatcgtaccaatgacttc
ctctctagccatttaatttccccaacaccagtaaattattcagtcatttatctccatatc
agtaatgaaaacgaaatgttatctgctgctatcaataaaaaactgaaacagggagtatta
atcaccgcagatttcatggctgatttatttgaacgttatgtatctcttacagagcaaatt
gaaaatacggtattagccccttttgaaaaaaccttaagtaaaacactagaacaaattact
aaacaggtaagtaatgaagataaagcggcaattaatttagagaagttagataaaatttta
gctaagactaaaactactacctcaatggacaatattgttagttatctttttaatacgata
aatagcactaaagctcaacatgaagagctgtctcaaaagttgaccacgactcaacaagaa
attaatcaattaaaagacaaactagcttcatcaagacaagaagctttagttgactcttta
accggtttattgaatcgtcgtggctgtgatgagaaattacaaaacttatctcacgccgat
actcattcctctttagccattgatattgatcattttaaaaaggttaatgacacctttggc
cactttattggggacaaagttattcagcgtatagcaaaaaccattcaaagccatattggt
gagcaagatctcgcggtacgttttggtggtgaagagtttgtggtggtaatgactaacact
ccccttgcagaggcaaaaaacattgctgagaaaatacgtattggtatctctaaaatgcga
ttaaagcaaagagataccaatacctttttacccccaatttcagtgtctattggtattgct
caaaatgataacatttcagagtggaccactctgtttgaacaagcagatactgcgctttat
caagctaaaaactccggacgcaactgctgtatttgtgcgtag

DBGET integrated database retrieval system