KEGG   Colwellia psychrerythraea: CPS_0820Help
Entry
CPS_0820          CDS       T00258                                 

Definition
(RefSeq) GGDEF domain protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
cps  Colwellia psychrerythraea
Brite
Enzymes [BR:cps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     CPS_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
835988..836989
Genome map
AA seq 333 aa AA seqDB search
MSFEDEYQVTSEFSDRTNDFLSSHLISPTPVNYSVIYLHISNENEMLSAAINKKLKQGVL
ITADFMADLFERYVSLTEQIENTVLAPFEKTLSKTLEQITKQVSNEDKAAINLEKLDKIL
AKTKTTTSMDNIVSYLFNTINSTKAQHEELSQKLTTTQQEINQLKDKLASSRQEALVDSL
TGLLNRRGCDEKLQNLSHADTHSSLAIDIDHFKKVNDTFGHFIGDKVIQRIAKTIQSHIG
EQDLAVRFGGEEFVVVMTNTPLAEAKNIAEKIRIGISKMRLKQRDTNTFLPPISVSIGIA
QNDNISEWTTLFEQADTALYQAKNSGRNCCICA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttgaagatgagtatcaagtaacgtctgaattcagcgatcgtaccaatgacttc
ctctctagccatttaatttccccaacaccagtaaattattcagtcatttatctccatatc
agtaatgaaaacgaaatgttatctgctgctatcaataaaaaactgaaacagggagtatta
atcaccgcagatttcatggctgatttatttgaacgttatgtatctcttacagagcaaatt
gaaaatacggtattagccccttttgaaaaaaccttaagtaaaacactagaacaaattact
aaacaggtaagtaatgaagataaagcggcaattaatttagagaagttagataaaatttta
gctaagactaaaactactacctcaatggacaatattgttagttatctttttaatacgata
aatagcactaaagctcaacatgaagagctgtctcaaaagttgaccacgactcaacaagaa
attaatcaattaaaagacaaactagcttcatcaagacaagaagctttagttgactcttta
accggtttattgaatcgtcgtggctgtgatgagaaattacaaaacttatctcacgccgat
actcattcctctttagccattgatattgatcattttaaaaaggttaatgacacctttggc
cactttattggggacaaagttattcagcgtatagcaaaaaccattcaaagccatattggt
gagcaagatctcgcggtacgttttggtggtgaagagtttgtggtggtaatgactaacact
ccccttgcagaggcaaaaaacattgctgagaaaatacgtattggtatctctaaaatgcga
ttaaagcaaagagataccaatacctttttacccccaatttcagtgtctattggtattgct
caaaatgataacatttcagagtggaccactctgtttgaacaagcagatactgcgctttat
caagctaaaaactccggacgcaactgctgtatttgtgcgtag

DBGET integrated database retrieval system