KEGG   Colwellia psychrerythraea: CPS_0821Help
Entry
CPS_0821          CDS       T00258                                 

Definition
(RefSeq) conserved hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_7 DUF4437 Cupin_2
Motif
Other DBs
NCBI-ProteinID: AAZ26739
UniProt: Q488E5
Position
complement(837156..837800)
Genome map
AA seq 214 aa AA seqDB search
MLNMNFDEQVFINTQEQPWVASPKAGVWRKPLAREDAERGHATSLVKFDPGASFTEHDHP
LGEEILVLSGTFSDHTGDYHAGSYFRNPEGFRHAPFSKDGCILLVKLHQFQSGDNEHVVI
DTANKSWSPGMGNLMVMPLHSFEGESTALVKWPKDERFQPHKHFGGEEIFVISGEFIDEH
GRYPEGSWIRSPHLSEHFPYVEQETIILVKVGHL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatatgaacttcgatgaacaagtatttattaatacacaggaacaaccttgggta
gcaagtcctaaagccggtgtttggcgtaagcctttagccagagaagatgcagaaagaggt
catgcaacgagcttggtaaaatttgatcccggcgctagctttactgaacatgatcacccg
ctaggcgaagagatccttgtcctctcaggcaccttttctgatcacactggcgattatcat
gcaggcagctactttcgaaaccctgaaggatttcgtcatgcaccttttagtaaagatggc
tgtatattattagtaaaacttcaccaatttcaatccggtgataatgaacatgttgtcatc
gataccgctaataaaagctggtcaccgggcatgggtaatttaatggttatgccgttgcat
agctttgaaggagaatcaaccgcacttgttaaatggcctaaagatgagcgatttcagcct
cataagcattttgggggtgaagaaatatttgtcattagtggcgaatttatagatgagcat
ggtcgctatccagaaggttcttggattcgtagccctcacctgagcgagcactttccgtat
gtagaacaggaaacgattatattggttaaggtgggccatctataa

DBGET integrated database retrieval system