KEGG   Colwellia psychrerythraea: CPS_0826Help
Entry
CPS_0826          CDS       T00258                                 

Definition
(RefSeq) putative dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00010  Glycolysis / Gluconeogenesis
cps00020  Citrate cycle (TCA cycle)
cps00260  Glycine, serine and threonine metabolism
cps00280  Valine, leucine and isoleucine degradation
cps00620  Pyruvate metabolism
cps00630  Glyoxylate and dicarboxylate metabolism
cps00640  Propanoate metabolism
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01120  Microbial metabolism in diverse environments
cps01130  Biosynthesis of antibiotics
cps01200  Carbon metabolism
Module
cps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cps_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
cps_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS_0826
   00020 Citrate cycle (TCA cycle)
    CPS_0826
   00620 Pyruvate metabolism
    CPS_0826
   00630 Glyoxylate and dicarboxylate metabolism
    CPS_0826
   00640 Propanoate metabolism
    CPS_0826
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPS_0826
   00280 Valine, leucine and isoleucine degradation
    CPS_0826
Enzymes [BR:cps01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     CPS_0826
Exosome [BR:cps04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CPS_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 GIDA Pyr_redox K_oxygenase HI0933_like 3HCDH_N AlaDh_PNT_C FAD_binding_2 FAD_oxidored DAO NAD_binding_2 Thi4
Motif
Other DBs
NCBI-ProteinID: AAZ24299
UniProt: Q488E0
Structure
PDB: 

Jmol
Position
complement(839604..841073)
Genome map
AA seq 489 aa AA seqDB search
MKVINVDVAIIGTGTAGMGAYRAAKKHTDKVVLIEGGAYGTTCARVGCMPSKLLIAAADA
SYHASQTDLFGIQVDRISVNGKAVMKRIQTERDRFVGFVVESVESFDEQDKIRGFAKFLD
EHTLQVDDHSQVIAKRIVIATGSRPNYPEFLAAAGSRLLTNDNLFELNDLPKSVAVFGPG
VIGLELGQALSRLGVIVKVFGRSGSVANLQDEEMKRYAEKTFNEEFYFDAKARVISTIEK
EDAVEVIYFDKSGQKTTESFQYVLAATGRKANVDKLGLENTSIELDKKNSPLFDELTLQT
SVDHIFVAGDANNTLTLLHEAADDGKVAGTNAGAYPVIAQGQRRAPLSVVFTEPQVASVG
LSLRQIEDLYADQDAANYVVGQVSFEGQGRSRVMGKNKGLLNVYADRTSGEFLGAEMFGP
AAEHIGHLLAWARQQQMTVQAMLTMPFYHPVIEEGLRTALRDAQQKLAIEKHDMNEFIMT
HDNAMKLVI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaatcaatgttgatgttgccattattggtacaggcactgcaggaatgggcgct
tatcgcgccgcaaaaaaacatactgacaaggtagttttaattgaaggcggagcttacggt
actacttgtgctcgcgttggttgcatgcctagtaaattattaattgcagcggcagatgcg
tcttatcacgccagtcaaacagacctttttggcattcaagttgaccgtattagcgttaat
ggtaaagcggtaatgaagcgcatacaaactgagcgagaccgttttgtcggctttgtggtt
gagtcagtagaaagcttcgatgaacaagataaaattcgcggctttgctaagtttctagat
gagcacaccttacaggtagatgatcacagccaagtaatcgcaaaacggattgtcatcgct
acaggctctcgtcctaattaccctgagtttttggctgctgccggaagccgtttattaacc
aatgataatttatttgaactgaacgatttaccaaagtctgtcgcagtatttggtccgggt
gttatagggctagaattaggtcaggccttaagtcgattaggcgtaatcgttaaagtattt
ggccgaagtggctctgttgcaaatttgcaagacgaagaaatgaaacgctacgctgagaaa
acctttaatgaagagttttattttgatgctaaagcacgcgtcattagtaccatagaaaaa
gaggatgctgttgaagtaatctacttcgacaaatcagggcaaaaaacgactgagtcattc
cagtatgtattagctgcaaccggtcgtaaagcgaatgtagataaactaggactagaaaat
actagcattgaacttgataaaaagaatagcccactatttgatgaattgactctgcaaacg
tcagttgatcatatttttgtcgcgggagatgccaacaataccttaacgctactacatgaa
gccgccgatgatggaaaagtggcaggaaccaatgcaggagcatacccagttatcgctcaa
ggacaaagacgtgctccattatccgttgtgtttactgaaccacaagttgccagtgtcggt
ttatcattgcgacaaatagaggatttatatgccgatcaagatgccgcaaattatgtggtt
ggccaagtcagttttgaaggacaaggtcgaagtcgcgttatgggtaaaaataaaggttta
ttaaatgtttacgcggatcgaacttcaggtgaatttttaggcgctgaaatgtttggccct
gctgctgagcatattggccacttactcgcctgggcaagacaacaacagatgacggttcaa
gcgatgcttaccatgcctttttatcatccggtaattgaggaaggtttacgcactgcactt
agagatgcacagcaaaaattagctattgagaaacatgacatgaatgagtttatcatgaca
catgacaatgcaatgaagttggtcatataa

DBGET integrated database retrieval system