KEGG   Colwellia psychrerythraea: CPS_0830Help
Entry
CPS_0830          CDS       T00258                                 

Definition
(RefSeq) hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ26625
UniProt: Q488D6
Position
843111..843323
Genome map
AA seq 70 aa AA seqDB search
MCSLVTLSKHYSTNSKTLLTESFGQRLLNIFTALSPFYVEQPHDKGSALYKYPTKRCKNN
LERSTDPSHS
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtagcctagtcactctaagcaaacactactcaacaaatagtaagacgcttttaacc
gaatccttcggacagcgtttgttgaacatttttacagcgttatcgcctttttatgtggaa
caaccacatgacaaaggctctgccttgtataaatacccaacaaaacgctgcaaaaacaat
ctcgaaagatcaacagaccctagtcatagttga

DBGET integrated database retrieval system