KEGG   Colwellia psychrerythraea: CPS_0842Help
Entry
CPS_0842          CDS       T00258                                 

Definition
(RefSeq) putative surface protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Big_2 DUF1566
Motif
Other DBs
NCBI-ProteinID: AAZ24823
UniProt: Q488C4
Position
857865..859814
Genome map
AA seq 649 aa AA seqDB search
MYFKAWFIPLIFILLTLAGCSDHADPPPPPPPERELVSIQLTIDSQEFPIGITHTATAIG
NYSDYSTESGIDYTWSTESETEGVATVDTAGNITGEITGNTKLIVTEQGITSSLDITISA
AVPQSIEIFPGNTSIAGGLDVQYQAIVLYSDGEEYDITRNNNATWIAESAPIAEFSGNDG
IAHTSERYEGGTYIDVQFEGVTANTRAVLKVSFPTVTQLIITPIERAADTTTAEITVPRG
QTIGFSATAYYSNNTSHVVTDETIWGTKDETVIKATDKSGTFHGEKVGNTDITAAFDGVV
GERAVEVSSAEFESIVVSLASDSFPVGLVRQATAKAEFVGDVSYNLSNQKNGFWQSSNTK
VATVDLSGMVTMRHPGETEISFLFNEVLTTTPLEVTLARVTEINISPLNPYFVGEGKKRQ
LTVMGTYDNFETLEITHNPRLKWEYYASDGELGFISNDEGEVDRKGMLHNFPTDQPLSIY
FTIKATMDGTHNQSVATFGATNILTNEAVTLNFIGPFTDIDAKNLLSFTDFSVLYRESGV
TGPADSTFIMVTFNEASLLCDSLVYDDFDDYRLPTAADLQAVWVKYDKTADEEYALYSNE
KWAVGQHFWTTDSDDEGNYSLVDLQRGVTGLSSTTDIRHYASCVRDTAL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtatttcaaagcttggtttatcccccttatttttatattgctgaccttagcgggttgt
agtgatcatgctgatccaccaccgccgccaccgccagagagagaacttgtaagtattcaa
ttaacgattgatagccaggaatttcctattggcattacccacacggctaccgctattggt
aactactccgattattcaactgaatcaggcattgattacacctggagcactgaaagtgag
actgaaggcgttgccactgttgacaccgcaggtaatattaccggcgaaattacaggcaat
actaagctcatcgttactgagcaaggtataactagttctttagatattacaattagtgca
gccgtaccacaaagtattgaaattttccctggtaacacttctatagcaggcggccttgat
gttcagtatcaggcgatagtgctttatagtgatggtgaagagtatgatataactcgtaat
aataatgcgacctggatagctgagagtgctcctatcgcagagttttctggtaatgacggc
atcgcacatacctctgaacgctatgaaggtggcacatatattgatgtgcaatttgaagga
gtaacagcaaatacaagagctgtgctgaaggtttcatttccaacggtaactcaattaatt
attacccccatcgagagagctgccgatacgacaacggctgaaattacagtgcctagaggt
caaaccattggtttttcagcaacggcttattattctaataacacctctcatgttgtaacc
gatgaaacaatttggggtacaaaagatgaaacagtcataaaagcaacagataagtcgggt
acgtttcatggggaaaaagtaggtaatactgatattaccgctgcgtttgatggtgttgtc
ggtgaaagagctgttgaggtaagcagtgctgagtttgaatcaattgtcgtttctttagct
agcgactcttttccagtcggccttgttagacaagccactgctaaggcggagtttgttggt
gatgtgagctataacttgagtaaccaaaaaaatggtttctggcaaagttcaaatactaaa
gttgcgacagtcgacttaagtggcatggtcactatgcgacacccaggtgagactgaaata
tcatttttgtttaatgaggtgcttacaacaacgcctcttgaggtgactctagccagagtt
accgaaattaatatctcccctctaaatccttattttgttggtgaagggaaaaaaaggcaa
ctaaccgtgatgggaacatatgataactttgaaacacttgagattacccataaccctaga
ttaaaatgggaatattatgcttctgatggagagttagggtttatttctaatgatgaagga
gaggttgatcgaaagggaatgctgcataatttccctacggatcagccactatctatctat
ttcacaataaaagccacaatggacgggacacataatcaatcagtcgctacatttggcgca
accaatattctaacgaatgaggcagtaacgttaaactttattgggccatttactgatatt
gatgctaagaacttattatctttcactgacttcagtgtgctttatcgtgaaagtggggtt
acagggccagccgactctacctttattatggtaacgtttaatgaagcgagccttctttgt
gatagcttggtatatgacgattttgatgattatagattgccaaccgcagcagatttacaa
gccgtttgggtgaagtatgataagactgccgatgaagaatatgcattgtatagcaatgaa
aagtgggctgtagggcaacatttttggactaccgactcagacgacgaagggaattactca
ttggtagacttacagcggggcgtaacaggtctttcttcgacaacggacattagacattat
gcgagctgtgttagagatactgcgctgtaa

DBGET integrated database retrieval system