KEGG   Colwellia psychrerythraea: CPS_0859Help
Entry
CPS_0859          CDS       T00258                                 

Gene name
pqqC
Definition
(RefSeq) coenzyme PQQ synthesis protein C
  KO
K06137  pyrroloquinoline-quinone synthase [EC:1.3.3.11]
Organism
cps  Colwellia psychrerythraea
Brite
Enzymes [BR:cps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.11  pyrroloquinoline-quinone synthase
     CPS_0859 (pqqC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AAZ28852
UniProt: Q488A7
Position
complement(875002..875757)
Genome map
AA seq 251 aa AA seqDB search
MQQPWTREQFEEMLRAKGQLYHIHHPFHIAMHQGECSVEQIQGWVANRFYYQVNIPIKDA
AILANCHDMETRRLWIQRILDHDGSVEDKTLGGIEAWLQLGQAVGLDRQDLLDEKFVLPG
VRFAVDAYVNFARRANWQQAACSSLTEMFAPQIHQSRLDSWPINYPWIETQGLQYFQMRL
SQARRDVNHGLQITLDHFTTRQAQDEALNILQFKLDILWSMLDAMTLAYQQDRAPYQGLI
AEPNYHKRIFK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaccatggacaagagagcagtttgaagaaatgctccgcgctaaagggcagctt
taccatattcatcacccatttcatattgccatgcaccaaggtgaatgtagtgttgagcaa
attcagggttgggtggcaaaccgtttttattaccaagtaaatattcctattaaagatgcc
gccatattagctaattgtcatgatatggaaactcgtcgtctatggatccaacgcatatta
gatcacgatggcagtgtagaagacaaaaccttaggtggtattgaagcctggttacaattg
ggccaagcggtaggattagatagacaagacttactggatgagaaatttgttttacctggg
gtgcgattcgccgtagatgcctatgtaaactttgctcgccgtgctaactggcagcaagct
gcatgttcgtcactgacggaaatgtttgcccctcaaatacatcaaagcaggctagacagt
tggcctataaattatccttggattgaaacacaaggcttacagtattttcaaatgcgctta
tctcaagcaagacgcgatgttaatcatggcctacaaatcaccttagatcactttactact
cgtcaagcacaagacgaggcattaaatattctccaatttaaattagatattttgtggagt
atgcttgatgctatgaccttagcatatcaacaggaccgagcgccttaccaaggtttaata
gctgagccaaattaccataagagaatttttaaatga

DBGET integrated database retrieval system