KEGG   Colwellia psychrerythraea: CPS_0890Help
Entry
CPS_0890          CDS       T00258                                 

Definition
(RefSeq) hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_CI_repr Jag_N
Motif
Other DBs
NCBI-ProteinID: AAZ26622
UniProt: Q487X6
Position
896199..896597
Genome map
AA seq 132 aa AA seqDB search
MTLNSNEIFERLLTLYETKKLNELSIKLGFKKNWGSSVKNRGSIPFEACTKACEEFNVSM
DYLIYGIENKLEKIDINELKLSVTEGVFAAIQTNLITLNKDVKISHVTEAITSEIKEVCN
INDESKQLKKVQ
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgaattcaaatgaaatttttgaaaggttattaaccctttatgaaacaaaaaaa
ctaaacgaactatcaataaaacttggttttaagaaaaactggggatcttctgtaaaaaat
agaggctcaattccatttgaggcttgcacgaaagcatgcgaagaatttaatgtttctatg
gattatttgatttatggaattgaaaataaattagaaaaaatagatataaatgaattgaaa
ttatcagttaccgaaggagtttttgcagcaatacaaactaacctaatcaccttaaataaa
gacgttaaaatctcacatgtaactgaagcaataacgtctgaaattaaagaagtttgtaat
attaacgatgagagcaaacaactaaagaaagttcagtaa

DBGET integrated database retrieval system