KEGG   Colwellia psychrerythraea: CPS_0892Help
Entry
CPS_0892          CDS       T00258                                 

Definition
(RefSeq) hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTP18 Ibs_toxin Peptidase_S49_N
Motif
Other DBs
NCBI-ProteinID: AAZ27715
UniProt: Q487X4
Position
896774..897244
Genome map
AA seq 156 aa AA seqDB search
MLKILIIICLLVVSNQASAKSKCELEWNALKSVQSQLRHKSTEYLRKKEHKKHDEYQKCR
KGKSKKSKSYKTTNNQKTTYKKYSDINYPTKNITNTISLKGKFKDEKQDAWIQYYDKPKE
CLFPKNIQEFSKCLSYRDEAAKKFDMEWTASHNEKN
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaatattaataataatctgcttattagtagtttcaaatcaagcctctgcaaaa
tctaaatgcgaactagaatggaatgcgcttaaaagtgttcaatctcaattaagacataaa
tctaccgaatatttaagaaagaaagaacataaaaagcacgacgaatatcaaaaatgccga
aaaggtaaaagtaagaagtcaaagagctataaaacaacaaacaatcaaaaaacaacgtat
aaaaaatatagcgatataaattacccaactaagaatataacgaatacgatatctctaaag
ggaaagttcaaggacgaaaaacaagatgcatggatacaatactatgacaaaccaaaagaa
tgtctattccctaaaaacatacaagaattttcaaagtgcttaagttatagggatgaagca
gcaaaaaaattcgatatggaatggacagcaagccacaatgaaaaaaattaa

DBGET integrated database retrieval system